SecReT4
Protein ID: 10954836
T4SS name [ID]Trb [244]
Gene symboltiorf16
Locus tagpTi-SAKURA_p017
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]15613..16014 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDO66170
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.7e-20, Aligned region: 5..100
Protein Sequence: 133 a.a.     [Download]
>gi|10954836|ref|NP_053256.1| hypothetical protein pTi-SAKURA_p017 [Agrobacterium tumefaciens]
MSHKIRIAIALAAFAAVSFIGLADPAFASSGGSLPWESPLQQIQQSITGPVAGFIALAAVAIAGGMLIFG
GELNDFARRLCYVALVGGVLLGATQIIALFGATGASIGEMEARTGPGIIEPVMLRAQGEGAHG
 
Nucleotide Sequence: 402 bp     [Download]
>gi|10954820|ref|NC_002147.1|:c16014-15613 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGTCGCATAAGATCAGGATTGCCATCGCGCTTGCGGCATTCGCCGCCGTCTCTTTCATCGGTTTGGCGG
ATCCGGCCTTCGCCTCTTCAGGCGGCAGTCTGCCGTGGGAATCCCCGCTTCAGCAAATCCAGCAATCGAT
CACCGGTCCGGTTGCCGGCTTCATCGCACTCGCCGCAGTCGCGATCGCCGGCGGCATGCTGATCTTCGGG
GGCGAGTTGAATGATTTCGCAAGGCGGCTTTGCTACGTCGCCCTCGTTGGCGGCGTTCTGCTCGGCGCGA
CACAGATCATCGCCCTGTTCGGCGCAACTGGCGCTTCGATTGGCGAGATGGAGGCTCGAACCGGGCCTGG
GATCATCGAACCGGTAATGCTTCGCGCGCAAGGGGAGGGGGCCCATGGCTGA
 Primer design