SecReT4
Protein ID: 10954837
T4SS name [ID]Trb [244]
Gene symboltiorf17
Locus tagpTi-SAKURA_p018
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]16004..16975 [-]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDO66169
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.4e-89, Aligned region: 22..288
AAA_19 [PF13245], Evalue: 1.3e-06, Aligned region: 137..183
FtsK_SpoIIIE [PF01580], Evalue: 4.5e-06, Aligned region: 139..195
AAA_16 [PF13191], Evalue: 6.7e-06, Aligned region: 136..185
Protein Sequence: 323 a.a.     [Download]
>gi|10954837|ref|NP_053257.1| hypothetical protein pTi-SAKURA_p018 [Agrobacterium tumefaciens]
MTQLRSHSRLVRKLQDALGDQLCVALDDATVVEIMLNPDGKLFIERLGHGVAPAGLLSPAAAEVIIGSVA
HALQSEADDEQPIISGELPIGGHRFEGLLPPVVSGPSFTIRRRASRLIPLDDYVKHKIMTAAQVSVLRSA
IASRMNIVISGGTGSGKTTLANAVIAEIVANAPDDRIVILEDTAEIQCAAENAVALHTSDTIDMARLLKS
TMRLRPDRIIVGEVRDGAALTLLKAWNTGHPGGVTTIHSNTAMSALRRLEQLTAEVSQQPMQEVIGEAVD
LIVSIERTGKGRRVREVIHVEGFANARYRTEHYAQIDEDSHVA
 
Nucleotide Sequence: 972 bp     [Download]
>gi|10954820|ref|NC_002147.1|:c16975-16004 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
GTGACCCAGCTGCGCTCTCACTCCCGTCTCGTCCGCAAACTCCAGGACGCACTCGGCGACCAGCTCTGCG
TCGCGCTCGATGACGCGACGGTCGTCGAGATCATGCTCAACCCCGATGGCAAGCTCTTCATCGAGCGCCT
GGGCCATGGCGTGGCCCCTGCAGGTTTGCTCAGCCCGGCCGCGGCAGAAGTGATCATTGGCAGCGTCGCG
CACGCACTGCAATCAGAAGCCGACGACGAGCAACCGATCATCTCCGGCGAATTGCCGATCGGCGGCCATC
GTTTCGAGGGCCTGCTGCCGCCAGTGGTTTCCGGACCGAGTTTCACTATCCGGCGGCGGGCCTCGCGCCT
GATCCCGCTCGACGACTATGTGAAGCATAAGATCATGACGGCGGCGCAGGTATCGGTTCTGCGCAGCGCG
ATCGCTTCTCGCATGAACATTGTGATTTCTGGCGGCACCGGTTCGGGCAAGACGACGCTTGCCAACGCGG
TCATTGCCGAAATCGTAGCGAATGCGCCGGACGATCGGATCGTCATTCTCGAAGACACGGCGGAGATCCA
ATGCGCCGCCGAGAACGCGGTCGCGCTCCACACGAGCGACACGATCGATATGGCCCGGCTTCTCAAGAGC
ACCATGCGTCTGCGGCCCGACCGGATCATCGTTGGTGAGGTGCGCGACGGGGCGGCCCTCACGCTACTCA
AGGCCTGGAACACCGGGCATCCGGGCGGCGTCACCACCATCCACTCGAACACGGCGATGTCGGCGCTTCG
CCGGCTCGAACAATTGACCGCGGAGGTGAGCCAGCAGCCCATGCAGGAAGTGATCGGCGAGGCGGTGGAC
CTGATCGTCTCGATAGAACGAACGGGGAAGGGGAGGCGGGTCCGTGAGGTCATCCATGTCGAGGGTTTCG
CAAACGCCCGCTACCGAACCGAGCACTACGCGCAGATCGATGAGGATAGTCATGTCGCATAA
 Primer design