SecReT4
Protein ID: 10954926
T4SS name [ID]Trb [244]
Gene symboltiorf106
Locus tagpTi-SAKURA_p108
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]97732..99681 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ9R6F3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1e-157, Aligned region: 164..635
TraG-D_C [PF12696], Evalue: 2.4e-32, Aligned region: 477..598
TrwB_AAD_bind [PF10412], Evalue: 2.4e-25, Aligned region: 304..611
AAA_10 [PF12846], Evalue: 1.5e-08, Aligned region: 242..556
Protein Sequence: 649 a.a.     [Download]
>gi|10954926|ref|NP_053346.1| hypothetical protein pTi-SAKURA_p108 [Agrobacterium tumefaciens]
MTANRILLAVVPATTMIAAVILMPGIEHWLAAFGRTAQAKLMLGRFGIALPYIAAAAIGTMFLFAANGAA
NIKTAGWGVVSGNVAAIIIAMIREAARLSGIAGSVPTDQSVLAYTDPATALGAAGPFLAGVFALRVVIKG
NAAFASPAPRRVRGKRAVHGEADWMGVVEAGRLFPDAGGIVIGERYRVDRDSVAGMSFRADQRETWGAGG
KSPLLCFDGSFGSSHGIVFAGSGGFKTTSVTIPTALKWGGGLVVLDPSSEVAPMVSEHRRKAGRKVIVLD
PATPAIGFNALDWIGRFGGTKEEDIVAVATWIMTDNARTASARDDFFRASAMQLLTALIADVCLSGHTDE
QDQTLRRVRANLSEPEPKLRERLTRIYEQSESEFVRENVAVFVNMTPETFSGVYANAVKETHWLSYPNYA
ALVSGDSFSTDDLAKGETDIFIALDLKVLEAHPGLARVVIGAFLNAIYNRNGEVEGRTLFLLDEVARLGY
LRILETARDAGRKYGITLTLIFQSLGQMREAYGGRDATSKWFESASWISFAAINDPDTADYISKRCGDTT
IEVDQTNRSTGMKGSSRSRSKQLSNRRLILPHEVMRMRTDEQIVFTAGNAPLRCGRAIWFRRDEMTRIVG
KNRFHQGDAPAKGPEPSTP
 
Nucleotide Sequence: 1950 bp     [Download]
>gi|10954820|ref|NC_002147.1|:c99681-97732 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
GTGACGGCGAATAGAATTCTCCTCGCCGTCGTCCCCGCCACGACGATGATCGCAGCGGTGATCCTGATGC
CGGGGATCGAGCACTGGCTGGCGGCGTTCGGAAGGACGGCGCAGGCGAAGCTGATGCTCGGGCGGTTCGG
CATCGCCCTGCCCTACATCGCAGCGGCTGCGATCGGCACGATGTTCCTGTTCGCGGCCAACGGTGCCGCC
AACATAAAGACGGCTGGATGGGGCGTCGTCAGCGGAAACGTCGCGGCGATTATCATCGCGATGATCCGCG
AGGCGGCTCGTCTTTCCGGCATCGCCGGAAGCGTCCCCACGGACCAGTCCGTCCTCGCCTACACGGACCC
GGCGACAGCGCTCGGTGCGGCCGGCCCATTCCTCGCCGGCGTCTTCGCACTTCGCGTCGTCATCAAGGGC
AACGCTGCATTTGCCAGTCCGGCGCCGCGCCGTGTCCGCGGCAAGCGGGCCGTGCATGGCGAGGCGGACT
GGATGGGCGTGGTCGAAGCGGGAAGACTGTTTCCCGATGCGGGCGGCATCGTCATCGGAGAACGCTATCG
CGTCGATCGCGACAGTGTGGCGGGCATGTCGTTCCGCGCCGATCAGCGCGAGACATGGGGCGCGGGCGGC
AAGTCCCCGCTGCTCTGCTTCGACGGCTCGTTCGGCTCGTCGCACGGCATCGTCTTTGCCGGCTCCGGCG
GTTTCAAGACGACATCGGTGACGATCCCGACGGCGCTCAAATGGGGTGGCGGGCTTGTGGTTCTGGACCC
GTCAAGCGAGGTGGCGCCGATGGTCTCGGAACACCGGCGCAAGGCCGGCCGAAAAGTGATCGTGCTCGAT
CCCGCCACGCCCGCCATCGGCTTCAACGCGCTCGACTGGATCGGGCGGTTCGGCGGCACGAAGGAGGAGG
ATATCGTGGCGGTCGCAACCTGGATCATGACCGACAACGCGCGCACCGCCTCCGCCCGCGACGACTTCTT
CCGGGCTTCCGCCATGCAGCTGCTGACTGCGTTGATCGCAGACGTGTGCCTGTCAGGGCATACGGACGAA
CAGGACCAGACGCTACGCCGGGTGCGCGCCAATCTCTCGGAGCCTGAACCGAAACTGCGCGAGCGGCTGA
CGCGGATTTACGAGCAGTCCGAATCCGAATTCGTCCGGGAGAACGTCGCGGTGTTCGTCAACATGACGCC
GGAGACGTTCTCCGGCGTCTATGCCAACGCCGTCAAGGAAACGCACTGGCTCTCCTATCCGAACTATGCC
GCCCTGGTGTCCGGCGACAGCTTCTCGACGGACGATCTCGCCAAGGGCGAGACGGACATCTTCATCGCAC
TCGACCTGAAAGTGCTGGAGGCACATCCGGGCCTTGCCCGCGTCGTGATCGGCGCGTTCCTGAACGCGAT
CTATAATCGCAACGGCGAGGTCGAGGGCAGGACGCTGTTTCTGCTCGACGAGGTGGCCCGTCTCGGCTAT
CTGCGCATCCTCGAGACAGCGCGCGATGCAGGTCGCAAATACGGTATCACGCTGACGCTGATCTTCCAGA
GCCTCGGGCAGATGCGCGAGGCCTATGGCGGTCGGGACGCCACGAGCAAATGGTTCGAGTCGGCGTCATG
GATCTCGTTTGCGGCGATCAACGATCCCGACACGGCCGACTACATCTCGAAGCGATGCGGCGACACGACG
ATCGAGGTCGACCAGACGAACCGGTCGACCGGAATGAAGGGATCGTCGCGCTCGCGGTCGAAGCAGCTTT
CGAACCGGCGGCTGATCCTGCCGCATGAGGTGATGCGCATGCGGACCGACGAGCAGATCGTGTTCACGGC
TGGCAACGCGCCGCTCAGATGCGGCCGCGCCATCTGGTTCCGCCGCGACGAGATGACGAGGATCGTCGGC
AAGAACAGGTTCCATCAAGGCGATGCGCCGGCCAAGGGGCCGGAACCTTCCACACCCTGA
 Primer design