SecReT4
Protein ID: 10954930
T4SS name [ID]Trb [244]
Gene symboltiorf110
Locus tagpTi-SAKURA_p112
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]104022..104552 [+]
Productconjugal transfer pilin processing protease TraF
Component typeTraF
UniProt IDQ9R6E9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 2.8e-45, Aligned region: 29..173
Protein Sequence: 176 a.a.     [Download]
>gi|10954930|ref|NP_053350.1| hypothetical protein pTi-SAKURA_p112 [Agrobacterium tumefaciens]
MTPRRAIILIGVSVTVILCGSVVAAVGGYRLNLTPSEPLGLWRIEALNRSPAVGDLVFICPPSNASFIEA
LERGYLRRGLCRGGFAPLIKTIVALPGDRVVISGEVVIDDRPIPASAVRATDGAGRAIHPYPGGVVPPGH
LFLHSSFASSYDSRYFGPIPASGLLGLARPVFTFDP
 
Nucleotide Sequence: 531 bp     [Download]
>gi|10954820|ref|NC_002147.1|:104022-104552 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGACGCCGCGCCGGGCGATCATCCTGATCGGGGTCTCAGTGACCGTCATTCTCTGCGGATCGGTTGTCG
CCGCGGTTGGCGGCTATCGCCTGAACCTGACGCCAAGCGAGCCGCTCGGGCTCTGGCGCATCGAGGCATT
GAACCGCTCCCCTGCGGTCGGGGATCTGGTGTTCATCTGCCCGCCGTCGAACGCGTCGTTCATCGAGGCG
CTGGAGCGCGGATATCTCCGCCGCGGGCTTTGCAGGGGCGGTTTTGCGCCCCTGATCAAGACCATTGTCG
CGCTTCCCGGCGACCGGGTCGTGATCAGCGGGGAGGTCGTCATCGACGATCGCCCGATACCCGCATCCGC
TGTGCGGGCGACAGATGGTGCCGGCAGGGCGATCCATCCCTATCCGGGCGGCGTCGTGCCACCCGGCCAT
CTCTTTCTTCACTCATCCTTTGCGAGCTCTTATGATTCACGATATTTTGGGCCGATCCCGGCATCCGGCC
TTCTCGGTCTGGCGCGGCCGGTGTTCACGTTTGACCCGTGA
 Primer design