SecReT4
Protein ID: 10954967
T4SS name [ID]VirB [6]
Gene symboltiorf147
Locus tagpTi-SAKURA_p149
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]146076..146243 [+]
Producttype IV secretion system lipoprotein VirB7
Component typeVirB7
UniProt IDP17797, Q7DKC7
KEGG IDatu:Atu6173
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 55 a.a.     [Download]
>gi|10954967|ref|NP_053387.1| hypothetical protein pTi-SAKURA_p149 [Agrobacterium tumefaciens]
MKYCLLCLALALGGCQTNDKLASCKGPIFPLNVGRWQPTPSDLQLSNVGGRHEGV
 
Nucleotide Sequence: 168 bp     [Download]
>gi|10954820|ref|NC_002147.1|:146076-146243 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGAAATATTGCCTGCTGTGCCTGGCTCTCGCTTTAGGCGGCTGCCAGACAAACGATAAATTGGCGAGCT
GCAAAGGCCCAATATTCCCGCTGAATGTGGGGCGATGGCAGCCTACGCCGTCAGATCTTCAGCTCAGCAA
CGTAGGTGGTCGCCATGAAGGGGTCTGA
 Primer design