SecReT4
Protein ID: 10954968
T4SS name [ID]VirB [6]
Gene symboltiorf148
Locus tagpTi-SAKURA_p150
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]146230..146943 [+]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDQ7DKC6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.2e-41, Aligned region: 23..227
Protein Sequence: 237 a.a.     [Download]
>gi|10954968|ref|NP_053388.1| hypothetical protein pTi-SAKURA_p150 [Agrobacterium tumefaciens]
MKGSEYALLVARETLAEHYKEVEAFQTARAKSARRLSKVIAAVATIAVLGNVAQAFTIATMVPLIRLVPV
YLWIRPDGTVDSEVSVSRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPMVRQNYQQFF
NYPNPTSPQVILGKHGRLEVEHIASNDVTPGVQQIRYKRTLIVDGKMPMASTWTATVRYEKVTSLPGRLR
LTNPGGLVVTSYQTSEDTVSNAGHSEP
 
Nucleotide Sequence: 714 bp     [Download]
>gi|10954820|ref|NC_002147.1|:146230-146943 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGAAGGGGTCTGAATACGCCTTGCTAGTAGCGCGGGAAACCCTGGCTGAGCACTACAAGGAAGTGGAAG
CTTTCCAAACTGCGCGTGCGAAATCAGCGCGGCGCCTCTCCAAGGTCATTGCAGCTGTCGCAACCATCGC
GGTTTTGGGGAATGTTGCGCAAGCCTTCACAATTGCCACCATGGTGCCGCTGATCAGGCTTGTGCCGGTA
TATCTTTGGATACGGCCGGATGGCACCGTTGACAGCGAGGTGTCCGTCTCCCGATTGCCTGCAACTCAAG
AGGAGGCCGTCGTTAACGCCTCACTGTGGGAGTATGTTCGGCTGCGCGAGAGCTATGATGCCGATACCGC
CCAGTACGCCTATGACCTGGTCTCGAACTTCAGCGCCCCAATGGTGCGCCAAAATTATCAGCAATTCTTC
AATTATCCCAATCCAACTTCGCCTCAAGTCATCCTCGGCAAACACGGCAGGCTAGAGGTCGAACACATCG
CTTCGAATGATGTTACTCCGGGTGTGCAGCAAATTCGCTATAAGCGAACCCTCATCGTTGACGGCAAAAT
GCCGATGGCGAGCACTTGGACTGCTACGGTTCGTTATGAAAAGGTGACCAGCTTGCCCGGCAGATTGAGA
CTGACCAACCCGGGAGGCTTGGTTGTCACCTCCTACCAGACATCGGAAGATACCGTTTCGAACGCAGGCC
ACAGCGAACCATGA
 Primer design