SecReT4
Protein ID: 10954971
T4SS name [ID]VirB [6]
Gene symboltiorf151
Locus tagpTi-SAKURA_p153
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]148992..150026 [+]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDQ9R6C0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4e-59, Aligned region: 12..310
Protein Sequence: 344 a.a.     [Download]
>gi|10954971|ref|NP_053391.1| hypothetical protein pTi-SAKURA_p153 [Agrobacterium tumefaciens]
MEVDPQLRILLKPILEWLDDPRTEEVAINRPGEAFVRQAGAFLKFPLPVSYDDLEDIAILAGALRKQDVG
PRNPLCATELPDGERLQICLPPTVPSGTVSLTIRRPSSRVSSLKEVSSRYDAPRWNQWKGRKKRHDQHDE
AILRYYDNGDLEAFLHACVVGRLTMLLCGPTGSGKTTMSKTLINAIPPQERLITIEDTLELVIPHENHVR
LLYSKNGAGLGAVTAEHLLQASLRMRPDRILLGEIRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKL
FSLVKSSAQGASLEDRTLIDMLATAVDVIVPFRAHGDIYEVGEIWLAADARRRGETIGDLLNQQ
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|10954820|ref|NC_002147.1|:148992-150026 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGGAGGTGGATCCGCAATTACGAATCCTTCTCAAGCCGATTTTGGAATGGCTCGATGACCCGCGGACCG
AAGAAGTTGCGATAAATCGACCTGGGGAGGCATTTGTGCGCCAGGCCGGCGCCTTCCTCAAGTTCCCTTT
GCCTGTCTCCTATGACGATCTCGAAGATATCGCTATTTTAGCAGGCGCGCTGAGAAAACAGGACGTTGGA
CCACGCAACCCACTTTGCGCAACTGAACTTCCAGACGGCGAGCGGCTGCAAATCTGTTTGCCGCCGACGG
TACCGTCGGGCACCGTCAGCTTGACGATTCGACGGCCAAGTTCCCGTGTTTCTAGTCTCAAAGAAGTCTC
GTCCCGTTACGATGCTCCGAGGTGGAATCAGTGGAAGGGACGAAAAAAACGGCATGATCAGCATGATGAA
GCTATCCTTCGGTACTATGACAACGGGGATCTGGAGGCGTTTCTGCACGCATGTGTCGTTGGTCGGTTGA
CGATGCTGCTTTGCGGACCCACCGGGAGTGGCAAGACAACGATGAGCAAGACCTTGATCAACGCTATCCC
GCCGCAGGAAAGGCTGATTACCATCGAAGATACGCTCGAACTCGTCATTCCACACGAGAACCACGTAAGG
CTGCTTTATTCTAAAAATGGGGCTGGGCTGGGCGCAGTGACCGCCGAGCACCTGCTACAGGCTAGCCTGC
GCATGCGACCGGACCGAATACTGCTCGGCGAGATACGCGACGATGCCGCGTGGGCTTATCTGAGTGAAGT
CGTCTCAGGGCATCCGGGATCGATTTCCACAATACATGGTGCCAATCCCGTCCAAGGTTTCAAAAAGCTA
TTTTCGCTCGTGAAAAGCAGCGCTCAGGGGGCTAGCTTGGAAGATCGCACCCTGATTGACATGCTCGCAA
CCGCAGTTGATGTCATCGTACCCTTCCGTGCCCACGGTGACATTTACGAGGTGGGCGAAATCTGGCTCGC
TGCCGATGCGCGTCGGCGCGGTGAGACAATAGGCGATCTTCTTAACCAGCAGTAG
 Primer design