SecReT4
Protein ID: 10954978
T4SS name [ID]VirB [6]
Gene symboltiorf158
Locus tagpTi-SAKURA_p160
StrainAgrobacterium tumefaciens plasmid pTi-SAKURA (NC_002147)
Repliconplasmid pTi-SAKURA [GenBank: NC_002147] [Browse all T4SS(s) in this replicon]
Location [Strand]156655..158661 [+]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDQ9R6B7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 9e-160, Aligned region: 97..537
TraG-D_C [PF12696], Evalue: 5.8e-28, Aligned region: 391..509
TrwB_AAD_bind [PF10412], Evalue: 1.1e-23, Aligned region: 138..522
AAA_10 [PF12846], Evalue: 4.8e-08, Aligned region: 140..467
Protein Sequence: 668 a.a.     [Download]
>gi|10954978|ref|NP_053398.1| hypothetical protein pTi-SAKURA_p160 [Agrobacterium tumefaciens]
MNSSKTTPQRLAVSIVCSLAAGFCAASLYVTFRHGFNGEAMMTFSVFAFWYETPLYMGHATPVFYCGLAI
VVSTSIVVLLSQLIISFRNHEHHGTARWAGFGEMRHAGYLQRYNGIKGPIFGKTCGPRWFGSYLTNGEQP
HSLVVAPTRAGKGVGVVIPTLLTFKGSVIALDVKGELFELTSRARKAGGDAVFKFSPLDPERRTHCYNPV
LDIAALPPERQFTETRRLAANLITAKGKGAEGFIDGARDLFVAGILTCIERGTPTIGAVYDLFAQPGEKY
KLFADLAEESRNKEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWADPLVKAATSRSDFSVYDLRRKRTC
VYLCVSPNDLEVVAPLMRLLFQQVVSILQRSLPGKDERHEVLFLLDEFKHLGKLEAIETAITTIAGYKGR
FMFIIQSLSALTGTYDDAGKQNFLSNTGVQVFMATADDETPTYISKAIGDYTFKARSTSYSQARMFDHNI
QISDQGAPLLRPEQVRLLDDNNEIVLIKGHPPLKLRKVRYYSDRMLRRLFECQIGALPEPASLMLSEGVH
RDGQDLSQQAAVTEAQGLGDIDSIPNNMEAATPQNSEMDDEQDSLPTGIDVPQGLIESDEVKEDAGGVVP
DFGVSAEMAPAMIAQQQLLEQIIALQQRYGPASSHSVK
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|10954820|ref|NC_002147.1|:156655-158661 Agrobacterium tumefaciens MAFF301001 plasmid pTi-SAKURA, complete sequence
ATGAATTCGAGCAAGACTACGCCCCAGCGTTTAGCTGTCAGCATCGTATGTTCGCTGGCAGCCGGTTTTT
GCGCGGCAAGTCTCTATGTAACATTTCGCCATGGTTTCAATGGCGAAGCGATGATGACGTTTAGCGTCTT
CGCCTTTTGGTACGAGACCCCGCTCTATATGGGTCATGCGACCCCCGTCTTCTATTGCGGTTTAGCCATT
GTCGTCTCGACGTCTATTGTTGTGCTGTTAAGCCAACTTATCATATCGTTTCGCAATCACGAGCATCATG
GCACGGCTCGTTGGGCGGGATTTGGCGAAATGCGGCACGCCGGTTACCTGCAGCGCTATAATGGTATCAA
GGGGCCGATCTTTGGCAAGACGTGTGGCCCTCGTTGGTTCGGCAGCTATCTGACCAATGGCGAACAGCCT
CACAGTCTTGTTGTCGCGCCAACGCGCGCCGGCAAAGGCGTTGGCGTCGTTATTCCGACGCTCCTAACCT
TCAAGGGTTCGGTGATAGCCCTCGACGTCAAAGGCGAGCTTTTTGAGCTGACTTCCAGAGCACGCAAAGC
GGGCGGCGACGCCGTTTTCAAGTTCTCACCTCTGGATCCAGAGCGACGGACTCATTGTTACAATCCCGTC
CTCGATATTGCAGCTTTACCGCCCGAGCGGCAGTTTACCGAGACGCGCCGCCTCGCCGCAAACCTCATCA
CGGCCAAAGGCAAGGGAGCGGAAGGCTTTATCGACGGCGCGCGGGACCTTTTCGTTGCGGGCATCCTTAC
CTGTATTGAGCGCGGTACGCCAACAATTGGTGCGGTCTACGACTTATTTGCTCAACCTGGAGAGAAGTAC
AAACTTTTTGCGGACCTCGCGGAAGAAAGCCGAAATAAAGAGGCTCAGCGTATTTTCGACAATATGGCGG
GTAACGACACGAAAATTTTGACTTCTTATACATCAGTGCTCGGCGACGGCGGACTTAACCTGTGGGCTGA
TCCATTGGTTAAAGCAGCGACAAGTCGATCAGATTTTTCCGTCTATGATCTGCGTCGGAAGAGGACCTGC
GTCTATCTTTGCGTCAGCCCCAACGACCTCGAGGTCGTGGCGCCATTGATGCGCCTCCTTTTTCAGCAGG
TCGTGTCAATTCTGCAGCGATCACTGCCAGGTAAAGATGAGCGGCATGAAGTTTTGTTTCTCCTTGACGA
ATTTAAACACCTGGGGAAGCTTGAGGCAATCGAGACCGCGATTACAACCATCGCCGGTTACAAAGGCCGC
TTCATGTTTATTATTCAGAGTCTCTCGGCCTTGACGGGCACCTACGATGACGCGGGCAAACAAAACTTTC
TCAGTAACACTGGCGTGCAAGTATTTATGGCCACGGCCGACGACGAAACACCGACCTATATCTCAAAAGC
TATCGGCGACTATACGTTCAAGGCGCGTTCGACCTCATACAGTCAAGCCCGAATGTTCGATCATAACATC
CAGATTTCCGATCAGGGGGCGCCGCTTTTGCGCCCCGAACAAGTGCGCTTGCTTGACGATAACAATGAAA
TCGTCCTTATTAAAGGGCATCCGCCTCTCAAACTACGAAAGGTGCGATATTATTCCGATCGTATGCTGAG
GCGCCTTTTCGAATGCCAAATTGGCGCCCTCCCTGAGCCCGCATCTTTGATGCTTTCGGAAGGTGTCCAT
CGGGATGGGCAAGACCTCAGTCAACAAGCCGCCGTCACGGAGGCGCAGGGCTTAGGTGACATCGATTCGA
TACCTAATAATATGGAAGCCGCTACACCGCAAAACAGTGAAATGGATGACGAGCAGGACAGCCTCCCAAC
TGGAATTGACGTCCCCCAGGGCCTTATTGAAAGCGATGAGGTGAAAGAAGACGCCGGTGGCGTGGTGCCA
GATTTCGGTGTTTCAGCTGAAATGGCTCCAGCTATGATTGCACAACAGCAGCTGCTGGAGCAGATCATTG
CGCTTCAGCAACGATATGGACCCGCGTCCTCGCACTCGGTGAAATGA
 Primer design