SecReT4
Protein ID: 10955036
T4SS name [ID]Trb [256]
Gene symboltraG
Locus tagpTi_020
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]28152..30074 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ44360
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.5e-161, Aligned region: 163..635
TraG-D_C [PF12696], Evalue: 6.2e-32, Aligned region: 477..598
TrwB_AAD_bind [PF10412], Evalue: 1.3e-23, Aligned region: 302..611
AAA_10 [PF12846], Evalue: 2.1e-06, Aligned region: 249..556
Protein Sequence: 640 a.a.     [Download]
>gi|10955036|ref|NP_059692.1| hypothetical protein pTi_020 [Agrobacterium tumefaciens]
MTVNRLLLLILPAAIMVAAMILTSGMEHRLAALGTTVQAKLMLGRAGLALPYIVAAAIGVIALFATNGSA
NIKAAGLSVLGGGAAVIIVAIAREIIRLNGISSHVPAGQSVLAYCDPATMVGAAAALFSGIFGLRVALKG
NAAFATGGPRRIGGKRAVHGETDWMKMQEAAKLFPDTGGIVIGERYRVDRDSVAAMPFRADEKQSWGAGG
KVPLLCFNGSFGSSHGIVFAGSGGFKTTSVTLPTALKWSSGLVVLDPSSEVAPMISEHRRQAGRKVIVLD
PTASGVGFNALDWIGRHGNTKEEDIVAVATWIMTDNPRTASARDDFFRASAMQLLTALIADVCLSGHTEG
EDQTLRQVRANLSEPEPKLRARLTKIYEGSESDFVKENVAVFVNMTPETFSGVYANAVKETHWLSYPNYA
GLVSGDSFSTGDLADGRTDIFIALDLKVLEAHPGLARVVIGSLLNAIYNRNGNVKGRTLFLLDEVARLGY
LRILETARDAGRKYGITLTMIFQSLGQMREAYGGRDATSKWFESASWISFSAINDPDTADYISKRCGDTT
VEVDQTNRSTGMKGSSRSRSKQLSRRPLILPHEVLRMRGDEQIVFTSGNPPLRCGRAIWFRRDDMSASVG
ENRFQPENKA
 
Nucleotide Sequence: 1923 bp     [Download]
>gi|10955016|ref|NC_002377.1|:c30074-28152 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGACGGTGAATAGGCTTTTGCTGTTGATCCTGCCCGCGGCAATCATGGTTGCAGCCATGATCCTGACGT
CAGGCATGGAACATCGGCTGGCGGCGCTCGGAACAACAGTGCAGGCGAAGCTTATGCTGGGACGCGCCGG
GCTCGCCCTGCCCTATATTGTTGCCGCCGCGATAGGCGTGATCGCGCTGTTCGCAACGAACGGATCGGCC
AATATCAAGGCGGCCGGCCTGAGCGTACTGGGAGGAGGTGCTGCGGTCATCATCGTCGCCATCGCACGCG
AGATAATCCGCCTGAACGGCATCTCCAGCCACGTGCCGGCGGGACAATCCGTTCTCGCCTATTGCGACCC
GGCGACGATGGTGGGTGCTGCCGCAGCACTCTTCAGTGGTATCTTCGGCTTGCGCGTCGCGCTGAAAGGC
AATGCAGCCTTCGCGACCGGCGGGCCTCGCCGGATCGGCGGAAAGCGCGCGGTCCATGGCGAGACTGACT
GGATGAAGATGCAGGAGGCGGCAAAGCTGTTTCCCGACACCGGTGGCATCGTGATTGGCGAACGGTATCG
CGTCGATCGTGACAGCGTTGCCGCGATGCCGTTTCGCGCTGATGAAAAACAGAGCTGGGGTGCTGGTGGG
AAAGTACCGCTGCTCTGCTTCAACGGATCATTTGGTTCGTCGCATGGAATCGTTTTTGCCGGTTCCGGTG
GTTTCAAGACGACCTCGGTGACACTCCCGACCGCGCTCAAATGGAGCAGTGGTCTCGTGGTGCTGGATCC
GTCGAGCGAGGTTGCGCCGATGATCAGCGAGCATCGCCGTCAGGCCGGCCGCAAGGTGATCGTGCTCGAT
CCGACCGCGTCTGGTGTCGGTTTCAATGCGCTGGACTGGATCGGCCGTCATGGCAATACCAAGGAAGAGG
ATATCGTCGCAGTCGCCACCTGGATCATGACCGACAATCCTCGCACGGCATCCGCCCGTGACGACTTCTT
CCGGGCATCGGCGATGCAACTCCTGACGGCCCTGATCGCCGACGTCTGCCTGTCAGGGCATACGGAAGGA
GAAGACCAGACATTGCGTCAGGTCCGCGCCAACCTCTCCGAACCTGAGCCGAAGCTTCGGGCGCGTCTGA
CGAAGATCTATGAAGGGTCCGAATCCGACTTCGTCAAAGAGAACGTCGCGGTCTTCGTCAATATGACGCC
GGAGACATTTTCCGGTGTCTACGCCAATGCAGTCAAGGAAACGCACTGGCTGTCCTATCCGAACTATGCC
GGTCTCGTCTCCGGCGATAGCTTCTCGACCGGCGATCTCGCCGACGGTCGCACCGACATCTTCATCGCGC
TCGATCTGAAGGTGCTGGAAGCTCATCCAGGACTGGCACGTGTTGTCATCGGCTCGCTGCTCAACGCGAT
CTATAACCGCAATGGTAACGTGAAGGGTCGCACCCTCTTCCTGCTCGACGAGGTGGCGCGTCTTGGATAC
CTGCGCATCCTAGAAACCGCCCGCGACGCCGGTCGCAAATACGGCATCACGCTGACCATGATCTTTCAGT
CACTCGGCCAGATGCGCGAGGCCTATGGCGGTCGTGATGCGACAAGCAAATGGTTCGAATCGGCATCGTG
GATTTCGTTTTCGGCAATAAACGACCCCGATACAGCCGACTACATTTCCAAGCGCTGCGGCGACACTACC
GTTGAGGTGGATCAAACCAACCGTTCCACCGGAATGAAGGGATCGTCGCGATCGCGGTCGAAGCAGCTCA
GCCGCCGCCCGCTTATCCTGCCACACGAGGTGCTGCGCATGCGGGGCGACGAGCAGATCGTCTTCACCTC
GGGCAACCCGCCGCTCCGGTGTGGCCGCGCCATCTGGTTCCGGCGTGACGATATGAGTGCCAGTGTCGGC
GAGAACAGGTTTCAGCCGGAGAACAAGGCGTGA
 Primer design