SecReT4
Protein ID: 10955040
T4SS name [ID]Trb [256]
Gene symboltraF
Locus tagpTi_024
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]34130..34660 [+]
Productconjugal transfer pilin processing protease TraF
Component typeTraF
UniProt IDQ44364
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 7.9e-44, Aligned region: 29..173
Protein Sequence: 176 a.a.     [Download]
>gi|10955040|ref|NP_059696.1| hypothetical protein pTi_024 [Agrobacterium tumefaciens]
MRRREVLLFLTGSRVRHVRTGVDSLIGGYRLNLTPSEPLGLWRIEALHRPVSIGDLVFFCPPMTAVFDEA
RRRGYVRRGLCAGGVAPLIKTVAALAAQNVEITDHIVIDGRSLPSSVVRKTDGEGRVLLPDPGGVVPPHH
LFLHSSFASSYDSRYFGPVPDSGLLGLARPVFTFDP
 
Nucleotide Sequence: 531 bp     [Download]
>gi|10955016|ref|NC_002377.1|:34130-34660 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGAGGCGGCGGGAAGTTCTTCTGTTTCTGACGGGCTCCAGAGTTCGTCATGTCAGGACTGGTGTCGATA
GCCTCATAGGCGGGTACCGGCTGAACCTAACGCCGAGCGAACCACTCGGGCTCTGGCGCATCGAGGCGTT
GCACCGTCCGGTCTCGATCGGCGATCTGGTGTTTTTCTGCCCGCCGATGACAGCCGTCTTCGACGAGGCG
CGCCGGCGAGGATATGTGCGCCGCGGATTGTGTGCCGGCGGTGTCGCGCCGCTTATCAAGACCGTCGCGG
CGCTGGCAGCTCAGAATGTCGAAATCACCGATCACATTGTTATTGATGGCCGGTCTCTGCCGTCATCCGT
CGTTCGGAAAACTGACGGCGAGGGCAGGGTGCTCTTGCCCGATCCCGGCGGTGTCGTGCCGCCGCATCAT
CTGTTTCTCCACTCATCCTTTGCGAGCTCCTATGATAGCCGATATTTTGGCCCGGTTCCGGATTCCGGTC
TTCTCGGTCTGGCGCGACCAGTCTTCACCTTTGATCCGTAG
 Primer design