SecReT4
Protein ID: 10955094
T4SS name [ID]Trb [256]
Gene symboltrbI
Locus tagpTi_078
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]96666..97967 [-]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDP54917
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.5e-63, Aligned region: 243..427
Protein Sequence: 433 a.a.     [Download]
>gi|10955094|ref|NP_059750.1| hypothetical protein pTi_078 [Agrobacterium tumefaciens]
MVQSLNLGGAQNSQAASGIRRINRLPIVVVIVLAVAFLGIIFYGLASRGLYFGRDKGPESSSGEPASTFA
DQIKRGVTDGIIGEPQQQTTFQPTPVETKQVDEKASNPFTPTPEQRRGQELEPEAVWRARLEREQQEQYL
RERQRQRMARLQANDAAYDAPLAIDRGKLEARTATDDTSAANTSTAISPTAGASDLYAAALRAGLGGQNI
DPNGQKSKEDFFNTDLKDLGYLPNRVVPQQSLYELKRGSVIPATLITGINSDLPGRITAQVSQNVYDSAT
GHRLLIPQGTKLFGRYDSKVSFGQSRVLVVWSDIIFPNGSTLQIVGMAGTDAEGYGGFKDKVNNHYFKTF
GSAVMIALIGTGIDMSVPQSSTLATQDTASDAARRNFAETFGRVADRTIQRNMDVQPTLEIRPGYKFNVL
VDQDIIFNGIYRN
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|10955016|ref|NC_002377.1|:c97967-96666 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGGTGCAGTCCCTCAACCTCGGCGGCGCGCAGAACAGTCAGGCGGCATCAGGCATCCGCCGGATCAATC
GCCTGCCGATCGTCGTCGTCATCGTGCTGGCGGTGGCCTTCCTCGGCATCATCTTCTATGGGCTCGCCTC
GCGCGGGCTTTATTTCGGGAGGGATAAAGGCCCGGAGTCCAGTTCCGGCGAACCCGCCTCAACTTTTGCC
GATCAGATCAAGCGCGGTGTCACCGACGGTATTATCGGCGAACCGCAACAGCAGACGACGTTTCAGCCGA
CACCTGTCGAGACGAAGCAGGTGGACGAAAAGGCGAGCAATCCGTTCACCCCGACGCCGGAACAGCGTCG
CGGACAGGAACTGGAGCCGGAGGCGGTCTGGCGGGCGCGTCTCGAGCGCGAGCAACAGGAGCAATATCTC
CGGGAGAGACAGCGCCAGCGCATGGCAAGGCTCCAGGCAAACGATGCCGCCTATGATGCGCCGCTCGCAA
TCGATCGCGGCAAGCTGGAGGCACGCACGGCAACAGACGATACTTCGGCCGCCAATACATCGACTGCGAT
CTCGCCGACGGCAGGCGCTTCCGATCTCTATGCCGCCGCCTTGCGTGCCGGTCTCGGCGGCCAGAACATC
GATCCCAATGGGCAGAAGAGCAAGGAAGACTTCTTCAACACGGATCTCAAGGACCTCGGCTACCTGCCAA
ACCGTGTTGTCCCACAACAGTCACTCTACGAACTGAAACGGGGCTCGGTGATCCCGGCGACCTTGATCAC
TGGCATTAATTCCGATCTGCCCGGCCGCATAACTGCCCAGGTCAGCCAGAACGTTTACGACAGTGCGACC
GGCCATCGCCTGCTGATCCCGCAAGGAACGAAACTCTTCGGCCGTTACGACAGCAAGGTCTCGTTCGGCC
AGAGCCGCGTGCTCGTCGTTTGGTCCGATATTATCTTCCCGAACGGCTCAACGCTGCAGATCGTCGGCAT
GGCAGGAACCGATGCTGAGGGCTACGGAGGCTTTAAGGACAAGGTGAACAACCATTATTTCAAAACCTTC
GGCTCGGCGGTGATGATTGCGCTGATTGGCACCGGGATCGACATGTCAGTGCCGCAGAGTTCGACGCTCG
CAACGCAGGACACGGCGTCAGATGCAGCGAGGCGTAACTTCGCGGAGACCTTCGGACGGGTCGCTGATCG
GACCATCCAACGCAATATGGATGTCCAGCCCACACTGGAGATCCGGCCTGGCTACAAGTTTAATGTGCTG
GTCGATCAAGACATCATATTCAACGGGATCTATCGGAATTGA
 Primer design