SecReT4
Protein ID: 10955095
T4SS name [ID]Trb [256]
Gene symboltrbH
Locus tagpTi_079
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]97977..98456 [-]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDP54916
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 2.2e-27, Aligned region: 50..155
Protein Sequence: 159 a.a.     [Download]
>gi|10955095|ref|NP_059751.1| hypothetical protein pTi_079 [Agrobacterium tumefaciens]
MMKTLAFIRRPLSHMPGLAAACILTVLLSGCQSIDTEGLVASNAPPEISGPAASAIAGDMVSRLAEQIGP
GKATVALKVDTSPFGQALEAALKGWGYAVVTDQKTDSGMTIVTLAYVIISFDGQVLARLSTNSVELGRAY
TVTSTGATATSALSLMRRG
 
Nucleotide Sequence: 480 bp     [Download]
>gi|10955016|ref|NC_002377.1|:c98456-97977 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGATGAAGACTCTTGCCTTCATTCGACGCCCCCTGAGCCATATGCCCGGCCTTGCTGCCGCCTGCATCC
TCACCGTCCTCCTTTCCGGGTGCCAATCGATCGACACAGAAGGTCTTGTCGCCAGCAACGCGCCGCCCGA
AATCTCAGGACCGGCGGCGAGCGCGATTGCCGGCGACATGGTCAGCCGCCTTGCCGAACAGATCGGGCCG
GGCAAAGCAACCGTTGCACTAAAGGTCGATACTTCACCCTTCGGTCAGGCACTGGAGGCGGCGCTGAAGG
GATGGGGCTATGCGGTCGTCACCGACCAGAAGACCGATAGCGGAATGACCATCGTCACGCTCGCCTATGT
CATCATATCATTCGACGGGCAGGTACTTGCGCGCCTTTCGACCAACAGCGTCGAACTCGGCCGCGCCTAC
ACGGTGACTTCGACCGGTGCCACGGCGACGAGCGCGCTTTCGCTGATGCGGCGCGGGTAG
 Primer design