SecReT4
Protein ID: 10955096
T4SS name [ID]Trb [256]
Gene symboltrbG
Locus tagpTi_080
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]98453..99307 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDP54915
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3e-59, Aligned region: 68..281
Protein Sequence: 284 a.a.     [Download]
>gi|10955096|ref|NP_059752.1| hypothetical protein pTi_080 [Agrobacterium tumefaciens]
MNIRHRRQRATLAIGLLVFAIVPLTVLDPRTALAADGVTANEAKGMGLSTQWRGSKGLVTKGADGKVIFL
YGEVQPSVVCSPLQVCDIELQGGEVVRDVLVGDTVRWKVEPRHRALAGGQAIHLIVKPSEPGLVTSMVVT
TSRRTYHIQLKSHPTQYMARVGFEYPEDVSTKLADVNARLEASTIPGTGVPAEQLSFSYSISGSAGWRPT
RVYSDGLKTYIQFPRSISGQDAPVLFVVSGGQNRIVNYRMKSNMMVVDYNIDRAVLVSGVGWKQQKVTIS
RGGR
 
Nucleotide Sequence: 855 bp     [Download]
>gi|10955016|ref|NC_002377.1|:c99307-98453 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGAATATCAGACACAGAAGACAACGGGCTACGCTGGCCATCGGCCTCTTGGTTTTTGCGATCGTCCCCT
TGACCGTACTCGACCCCCGGACTGCGCTCGCCGCTGATGGTGTCACGGCCAATGAGGCGAAAGGCATGGG
GCTCTCGACCCAATGGCGCGGGTCGAAAGGCCTAGTCACCAAGGGCGCGGACGGTAAGGTGATTTTTCTC
TATGGCGAGGTTCAGCCATCGGTCGTCTGCTCACCGCTGCAGGTCTGCGATATCGAACTTCAGGGCGGCG
AGGTGGTGCGCGATGTGCTGGTCGGCGATACGGTCCGCTGGAAAGTAGAGCCGCGACATCGGGCGCTGGC
CGGGGGCCAGGCCATCCATCTTATCGTCAAGCCATCCGAACCGGGACTTGTCACCTCGATGGTGGTGACC
ACATCTCGGCGGACATATCATATCCAGCTCAAGTCGCATCCCACGCAATACATGGCCCGCGTCGGCTTCG
AATACCCCGAGGATGTGTCCACGAAACTCGCCGACGTCAACGCGCGGCTTGAAGCCAGTACGATCCCCGG
CACCGGGGTGCCGGCGGAGCAGCTAAGCTTTTCCTATTCCATATCAGGCAGTGCCGGCTGGCGGCCGACA
CGGGTCTATTCCGATGGCCTGAAAACCTACATCCAGTTCCCGCGGTCGATCTCGGGTCAAGATGCGCCGG
TTCTCTTCGTCGTCTCCGGTGGCCAGAACCGTATCGTCAACTACCGCATGAAGAGCAATATGATGGTGGT
CGATTACAACATCGATCGCGCCGTGCTCGTCTCAGGCGTCGGCTGGAAACAACAAAAGGTGACGATTAGC
AGGGGAGGGCGATGA
 Primer design