SecReT4
Protein ID: 10955097
T4SS name [ID]Trb [256]
Gene symboltrbF
Locus tagpTi_081
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]99324..99986 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDP54914
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.7e-43, Aligned region: 13..218
Protein Sequence: 220 a.a.     [Download]
>gi|10955097|ref|NP_059753.1| hypothetical protein pTi_081 [Agrobacterium tumefaciens]
MAGTTPPDNPYIAARNEWNERYGSYVKAAAAWRIVGITGMTMAVIGFGYALYQSTQVKLIPYIVEVDKLG
TAVNAGFPQQIEYADPRVVRATLGSFVSNFRSVTPDAVVQKQYIDRTYGLLRTSDPATEKVNAWFRSNSP
FEKAKTATVAIEVNNIVALSNQSYQVDWTEFERDRRGKETATRRFRGIATVTLTPPQDEGVIRLNPIGLY
LRDFDWTAQL
 
Nucleotide Sequence: 663 bp     [Download]
>gi|10955016|ref|NC_002377.1|:c99986-99324 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGGCTGGAACCACTCCACCAGATAACCCCTATATCGCTGCGCGCAACGAATGGAACGAACGTTACGGCT
CATACGTGAAAGCGGCCGCCGCCTGGCGCATTGTCGGCATCACCGGTATGACAATGGCGGTGATCGGTTT
CGGCTATGCCCTCTATCAGAGCACGCAGGTGAAGCTCATCCCCTACATCGTTGAGGTCGACAAACTCGGG
ACGGCCGTCAATGCCGGCTTTCCGCAACAGATCGAATACGCCGATCCGCGCGTGGTGCGTGCCACGCTCG
GCAGTTTCGTCTCAAACTTCCGCTCCGTCACGCCCGACGCCGTCGTCCAGAAACAATATATCGACCGGAC
CTACGGGCTGCTGCGGACATCCGATCCGGCGACCGAAAAGGTCAATGCCTGGTTCCGCTCGAACTCGCCG
TTCGAGAAGGCGAAGACCGCAACGGTCGCGATCGAGGTCAACAACATCGTCGCGCTATCGAACCAGAGTT
ATCAGGTCGACTGGACCGAATTCGAGCGCGATCGGCGAGGCAAGGAAACGGCGACACGCCGCTTCCGCGG
CATTGCCACTGTGACGCTGACGCCACCCCAGGACGAAGGCGTCATCCGTCTTAATCCAATCGGTCTCTAT
CTCCGCGACTTCGACTGGACTGCACAGCTTTGA
 Primer design