SecReT4
Protein ID: 10955098
T4SS name [ID]Trb [256]
Gene symboltrbL
Locus tagpTi_082
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]100001..101188 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDP54913
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-29, Aligned region: 66..278
Protein Sequence: 395 a.a.     [Download]
>gi|10955098|ref|NP_059754.1| hypothetical protein pTi_082 [Agrobacterium tumefaciens]
MVVHPSPKLELAFVTIGFVLLASSPALAQQGQVLTTLENSVVTAAKGWETTVMNAARSLFWILAGIEVGI
AAVWLAINAASLDSWFAELVKRIMFIGLFAFILDRGLEFAKAVVDSLYQIGAGGGSASPANIFDAGIRVA
TKMSEQAKFGLWEDNALAIAAVFAMVVVVVSFSLVAAIFVAVMVEMYVGLLAGMIMLGLGGSSYTKDFAV
KYLVYAFSVGMKLMALVMIARIGSDILLGLAEAPTATSEQFITTLAIAGISVVVFVIAMYVPPILQGLVQ
GASVGGGMEAIRHGGQAASAALGAGFLTIGAANRGFAAASAARAGGASLAGAAMRGLEAGVGGAAGAVGS
AAKDKAIGSPGAYAGSMLGLANAKLDQQSGRPGTPPPPPPINDKK
 
Nucleotide Sequence: 1188 bp     [Download]
>gi|10955016|ref|NC_002377.1|:c101188-100001 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGGTAGTTCACCCTTCCCCCAAGCTCGAACTGGCTTTCGTCACGATCGGCTTCGTCCTGCTGGCAAGTT
CGCCGGCGCTGGCGCAGCAGGGACAGGTTCTGACAACGCTGGAAAACTCCGTCGTCACCGCCGCCAAGGG
CTGGGAAACGACGGTCATGAACGCCGCACGATCGTTGTTCTGGATCCTCGCCGGCATCGAGGTCGGTATC
GCCGCCGTATGGCTGGCGATCAACGCCGCCTCGCTCGACAGCTGGTTTGCCGAACTCGTCAAACGCATCA
TGTTCATCGGCCTGTTCGCCTTCATCCTCGACAGGGGCCTGGAGTTCGCCAAGGCCGTGGTCGACAGCCT
CTATCAGATCGGTGCGGGCGGCGGTTCGGCCTCGCCTGCCAATATCTTCGACGCTGGTATTCGCGTTGCG
ACTAAAATGTCGGAACAGGCGAAGTTCGGGCTCTGGGAGGATAACGCACTGGCCATCGCTGCCGTCTTCG
CCATGGTCGTGGTTGTCGTGTCCTTCTCGCTGGTCGCGGCGATCTTCGTCGCCGTGATGGTCGAGATGTA
TGTCGGTCTGCTTGCCGGCATGATCATGCTCGGGCTTGGCGGCTCGTCCTACACCAAGGACTTTGCCGTC
AAATATCTGGTCTATGCTTTCTCAGTCGGCATGAAGTTGATGGCGCTGGTGATGATCGCCAGGATCGGCT
CCGATATCCTGCTCGGTTTGGCCGAAGCGCCGACGGCGACATCTGAACAGTTCATCACCACCTTGGCGAT
CGCCGGCATCTCGGTCGTGGTCTTCGTCATCGCCATGTATGTACCGCCGATACTGCAGGGTTTGGTCCAG
GGTGCATCAGTCGGCGGCGGTATGGAGGCCATTCGTCACGGTGGGCAAGCTGCCTCTGCCGCACTCGGCG
CCGGGTTCCTCACGATCGGCGCGGCCAACCGGGGCTTTGCGGCAGCAAGTGCAGCGAGGGCAGGGGGAGC
GTCACTGGCAGGTGCCGCCATGCGCGGGCTGGAAGCCGGCGTTGGCGGAGCGGCCGGCGCAGTTGGCTCG
GCTGCCAAGGACAAGGCCATCGGCTCACCGGGCGCCTATGCCGGTTCGATGCTCGGCCTCGCCAACGCCA
AGCTCGACCAGCAATCCGGCCGGCCCGGTACACCGCCACCACCACCGCCGATCAATGACAAGAAATAA
 Primer design