SecReT4
Protein ID: 10955100
T4SS name [ID]Trb [256]
Gene symboltrbJ
Locus tagpTi_084
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]101406..102215 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDP54911
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2749 [PF10907], Evalue: 1.8e-06, Aligned region: 245..269
Protein Sequence: 269 a.a.     [Download]
>gi|10955100|ref|NP_059756.1| hypothetical protein pTi_084 [Agrobacterium tumefaciens]
MPIHSSRPTRLARHAMIAAILLSSTSPMPAVAGGVTGQATEWTQLANNTELISLVGKSAEQVNNQITQIS
QLAEQIQNQLNIYRNMLQNTAQLPNHIWGQVENDLKNLQNVVNEGQGVAFSMGNVEDVMKQRFQSFAEMK
SNLPDGASFSTTYQNWSGTNRDTIAGTLKAANLTSEQFSSEESTMSSLRSMSESSDGQMKALQVGHQIAA
QQVAQMQKLRGLVSQQMTMMGTWYQSEQAQKDLAQARREQFFSGTEHDIRGGQTMEPRW
 
Nucleotide Sequence: 810 bp     [Download]
>gi|10955016|ref|NC_002377.1|:c102215-101406 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGCCGATACACTCTTCCCGGCCGACTAGACTAGCCCGCCACGCGATGATTGCGGCCATCCTTCTCTCAA
GTACCTCACCGATGCCAGCTGTGGCGGGCGGCGTGACCGGTCAGGCGACCGAATGGACGCAGCTCGCCAA
CAACACCGAACTCATCTCTTTGGTCGGCAAATCGGCGGAGCAGGTCAACAACCAGATCACCCAGATCTCA
CAGCTGGCCGAGCAGATCCAGAACCAGCTCAATATCTACAGGAACATGCTTCAAAACACCGCGCAGCTGC
CGAACCATATCTGGGGGCAGGTCGAGAACGACCTCAAAAACCTGCAGAACGTCGTCAACGAGGGGCAGGG
TGTCGCCTTCTCAATGGGCAATGTCGAAGATGTCATGAAGCAGCGTTTCCAGAGTTTTGCCGAGATGAAA
AGCAATCTGCCTGATGGTGCGAGCTTTTCCACGACCTACCAGAACTGGTCCGGCACAAATCGCGATACGA
TCGCCGGCACACTGAAGGCCGCGAACCTGACGTCGGAACAATTCTCCAGCGAGGAAAGTACCATGTCGTC
GTTGCGCTCCATGTCGGAATCATCCGACGGCCAGATGAAGGCCCTGCAGGTCGGGCATCAGATCGCCGCC
CAGCAGGTGGCGCAGATGCAGAAGCTGCGTGGTCTCGTCTCGCAACAGATGACGATGATGGGCACCTGGT
ATCAGTCGGAGCAGGCACAAAAGGATCTGGCTCAAGCAAGGCGTGAACAGTTCTTCAGCGGGACCGAACA
CGACATCCGCGGCGGCCAGACGATGGAGCCACGCTGGTGA
 Primer design