SecReT4
Protein ID: 10955101
T4SS name [ID]Trb [256]
Gene symboltrbE
Locus tagpTi_085
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]102187..104649 [-]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDP54910
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 8.9e-59, Aligned region: 185..400
AAA_10 [PF12846], Evalue: 6.2e-32, Aligned region: 457..731
Protein Sequence: 820 a.a.     [Download]
>gi|10955101|ref|NP_059757.1| hypothetical protein pTi_085 [Agrobacterium tumefaciens]
MVALKSFRHSGPSFADLVPYAGLVDNGVILLKDGSLMAGWYFSGPDSESSTDAERNDVSRQINAILSRLG
SGWMIQVEAVRVPTADYPKESDCHFPDLVTRAIDAERRAHFQKERGHFESRHALILTWRPPEPRRSGLTR
YIYSDTASRSATYADKALESFSTSIREVEQYLANVVSIRRMMTRETSERGCFRVARYDELFQFIRFCVTG
QNHPVRLPEIPMYLDWLVTAELQHGLTPLIENRFLGVVAIDGLPAESWPGILNALDLMPLTYRWSSRFVF
LDAEEARANLERTRKKWQQKVRPFFDQLFQTQSRSLDQDAMMMVAETEDAIAEASSQLRAYGYYTPVIVL
FEEDQARLQEKCEAVRRLIQAEGFGARIETLNATDAFLSSLPGVSYANIREPLINTRNLADLIPLNSVWS
GSAVAPCPFYPPASPPLMQVASGSTPFRLNLHVDDVGHTLIFGPTGSGKSTLLSLIAAQFRRYSGAQIFA
FDKGGSMLSLTLGIDGDHYQIGGDATEGGDGKALSFCPLADLTTDGDRAFAAEWIEMLVALQGVTITPDY
RNAISRQVGLMAESRGRSLSDFVSGVQMREIKDALHHYTVDGPMGQLLDAEEDGLALGSFQCFEIEELMN
MGERNLVPVLTYLFRRIEKRLTGAPSLIILDEAWLMLGHPVFRDKIREWLKVLRKANCAVVLATQSISDA
ERSGIIDVLKESCPTKICLPNGAAREPGTREFYERIGFNERQIEIVATAIPKRDYYVVSPEGRRLFDMAL
GPVALSFVGASGKEDLKRIRALHSEHGAAWPLQWLQQRGIAHADTLFPAD
 
Nucleotide Sequence: 2463 bp     [Download]
>gi|10955016|ref|NC_002377.1|:c104649-102187 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGGTTGCCCTCAAATCCTTCCGTCATTCCGGACCATCCTTCGCCGATCTCGTGCCCTATGCCGGCCTGG
TCGATAACGGCGTCATCCTGCTGAAGGACGGCTCGCTGATGGCCGGCTGGTATTTTTCCGGCCCTGACAG
CGAAAGCTCGACGGACGCCGAGCGCAACGATGTCTCCCGCCAGATCAATGCGATCCTGTCACGACTCGGC
TCCGGCTGGATGATTCAGGTCGAGGCCGTCAGGGTGCCGACAGCAGATTACCCCAAAGAATCCGACTGCC
ATTTTCCTGATCTCGTCACCCGCGCTATCGATGCGGAACGACGGGCACATTTTCAGAAGGAAAGAGGGCA
TTTCGAGAGCCGGCATGCGCTGATCCTGACCTGGCGGCCGCCGGAGCCTCGCCGCTCCGGCCTGACCCGC
TATATCTATTCGGACACCGCCAGCCGCTCCGCCACCTATGCCGATAAGGCGCTGGAGAGCTTTTCGACAT
CGATCCGTGAGGTCGAGCAGTATCTCGCCAATGTCGTGTCCATCCGCCGAATGATGACACGCGAGACGTC
GGAGCGCGGCTGCTTTCGTGTTGCCCGCTATGACGAGCTCTTCCAGTTCATCCGCTTTTGCGTCACCGGC
CAGAACCATCCGGTGCGCCTGCCGGAAATTCCCATGTATCTCGACTGGCTGGTGACTGCGGAACTCCAGC
ACGGGCTGACGCCGCTCATCGAGAATCGCTTTCTTGGCGTCGTCGCGATCGACGGGCTGCCGGCGGAAAG
CTGGCCCGGCATTCTCAACGCGCTCGACCTCATGCCGCTGACCTATCGATGGTCGTCGCGTTTCGTCTTT
CTGGACGCGGAGGAAGCGCGTGCAAATCTCGAACGCACCCGAAAGAAATGGCAACAAAAGGTGCGGCCCT
TCTTCGACCAGCTGTTCCAGACGCAATCGCGATCGCTCGATCAGGACGCCATGATGATGGTGGCCGAGAC
CGAGGACGCAATCGCAGAGGCCTCTTCGCAACTCCGTGCGTACGGCTATTACACGCCGGTCATCGTCCTG
TTCGAGGAAGATCAGGCACGCCTGCAGGAGAAGTGCGAGGCAGTCCGCCGTCTGATCCAGGCGGAAGGCT
TTGGCGCCCGCATCGAGACACTCAATGCGACCGACGCCTTCCTCAGCAGTCTTCCAGGCGTTTCCTATGC
CAATATCCGCGAGCCGCTGATCAATACACGCAATCTCGCTGATCTCATTCCCCTCAATTCGGTCTGGTCC
GGAAGCGCGGTCGCACCGTGCCCCTTTTATCCGCCAGCCTCACCGCCACTGATGCAGGTGGCGTCGGGTT
CGACCCCATTTCGGCTGAACCTGCATGTCGACGATGTTGGTCATACGCTGATCTTCGGTCCGACCGGATC
CGGCAAATCCACCTTGTTGTCGCTGATCGCTGCGCAGTTCCGCCGTTATTCCGGTGCGCAAATCTTCGCA
TTCGATAAGGGCGGCTCGATGTTATCGCTGACGCTTGGGATCGATGGCGATCATTACCAGATCGGCGGAG
ATGCGACCGAAGGAGGGGACGGGAAGGCACTGTCGTTCTGCCCGCTCGCAGACCTCACGACCGACGGCGA
CCGCGCCTTCGCGGCCGAATGGATCGAGATGCTCGTTGCGCTGCAGGGCGTGACGATCACGCCCGACTAT
CGCAACGCCATCTCCCGACAGGTCGGGCTGATGGCGGAATCACGCGGGAGGTCGCTATCGGACTTCGTGT
CGGGCGTGCAGATGCGCGAGATCAAGGATGCGCTGCATCACTACACTGTCGACGGGCCGATGGGCCAGCT
TCTCGACGCCGAGGAAGACGGTCTGGCGCTGGGCAGCTTCCAGTGCTTCGAAATCGAGGAGCTTATGAAC
ATGGGCGAGCGCAATCTCGTGCCCGTGCTCACCTATCTGTTCCGCCGCATCGAAAAGCGCCTGACCGGCG
CACCCAGCCTGATCATTCTGGACGAAGCCTGGCTAATGCTCGGCCATCCAGTTTTCCGCGACAAGATCCG
CGAATGGTTGAAGGTGCTGCGCAAGGCCAACTGCGCCGTCGTTCTTGCCACGCAGTCGATCTCGGACGCC
GAACGCTCCGGCATCATCGACGTCCTGAAGGAGAGCTGCCCGACCAAAATTTGCCTGCCGAACGGGGCGG
CCCGAGAGCCGGGCACGAGGGAATTCTACGAGCGCATCGGCTTCAACGAGCGCCAGATCGAGATCGTCGC
GACCGCCATTCCGAAGCGAGATTATTACGTCGTCTCGCCGGAGGGCCGTCGTCTCTTCGACATGGCGCTA
GGACCAGTAGCGCTCTCCTTCGTCGGAGCGTCCGGCAAGGAAGATCTGAAGCGCATCCGCGCGCTTCATT
CAGAACACGGGGCCGCATGGCCTCTTCAATGGCTCCAGCAAAGGGGGATCGCCCATGCCGATACACTCTT
CCCGGCCGACTAG
 Primer design