SecReT4
Protein ID: 10955102
T4SS name [ID]Trb [256]
Gene symboltrbD
Locus tagpTi_086
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]104660..104959 [-]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDP54909
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 9.8e-27, Aligned region: 1..92
Protein Sequence: 99 a.a.     [Download]
>gi|10955102|ref|NP_059758.1| hypothetical protein pTi_086 [Agrobacterium tumefaciens]
MAESGSALVRSRVHRALSRPNLLMGADRELVLLTALAAIILIFVVLTWYAALFGIAIWLIVVGALRTMAK
ADPLMRRVYIRHISYKNFYRATSSPWRKF
 
Nucleotide Sequence: 300 bp     [Download]
>gi|10955016|ref|NC_002377.1|:c104959-104660 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGGCTGAATCTGGCTCGGCTCTCGTGAGGTCGCGGGTTCACAGGGCGCTATCACGTCCGAACCTGCTGA
TGGGTGCCGATCGTGAGCTGGTACTATTGACGGCGCTGGCCGCCATCATCCTGATCTTCGTGGTGCTGAC
CTGGTACGCCGCGCTATTCGGGATCGCGATCTGGCTGATCGTGGTTGGGGCGCTTCGCACGATGGCGAAA
GCCGACCCGTTGATGCGGCGGGTCTATATCAGGCACATCTCCTACAAAAACTTCTACCGGGCGACATCGT
CGCCATGGCGCAAATTCTGA
 Primer design