SecReT4
Protein ID: 10955103
T4SS name [ID]Trb [256]
Gene symboltrbC
Locus tagpTi_087
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]104952..105356 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDP54908
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.2e-20, Aligned region: 4..100
Protein Sequence: 134 a.a.     [Download]
>gi|10955103|ref|NP_059759.1| hypothetical protein pTi_087 [Agrobacterium tumefaciens]
MSLKTHHTPIFTALALVALGSLDGALASSGGGSLPWESPLQQIQQSITGPVAGFIALAAVAIAGAMLIFG
GELNDFARRLCYVALVGGVLLGATQIVALFGATGASIGELHSQVDPFGYSPSPKLIERGEGAHG
 
Nucleotide Sequence: 405 bp     [Download]
>gi|10955016|ref|NC_002377.1|:c105356-104952 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGTCGCTTAAAACCCATCATACCCCGATATTCACGGCACTGGCCCTCGTCGCGCTCGGCTCCCTGGATG
GGGCACTGGCATCTTCCGGTGGCGGCAGCCTTCCCTGGGAATCGCCACTGCAGCAAATCCAACAGTCGAT
CACCGGTCCCGTCGCCGGCTTCATCGCGCTTGCCGCCGTCGCCATCGCTGGTGCGATGCTGATCTTCGGC
GGGGAGCTGAACGACTTTGCCCGACGGCTTTGCTACGTCGCGCTGGTTGGTGGCGTCCTGCTCGGCGCCA
CCCAGATCGTCGCCCTATTCGGTGCGACAGGGGCGTCGATCGGTGAGCTTCATTCGCAGGTTGACCCGTT
TGGGTACTCTCCCTCCCCCAAGCTGATTGAAAGAGGGGAGGGGGCTCATGGCTGA
 Primer design