SecReT4
Protein ID: 10955104
T4SS name [ID]Trb [256]
Gene symboltrbB
Locus tagpTi_088
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]105346..106317 [-]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDP54907
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.6e-88, Aligned region: 22..288
AAA_19 [PF13245], Evalue: 2.9e-06, Aligned region: 136..179
FtsK_SpoIIIE [PF01580], Evalue: 4.3e-06, Aligned region: 137..188
DEAD [PF00270], Evalue: 5.3e-05, Aligned region: 130..186
AAA_30 [PF13604], Evalue: 6.5e-05, Aligned region: 129..202
AAA_16 [PF13191], Evalue: 6.9e-05, Aligned region: 135..178
Protein Sequence: 323 a.a.     [Download]
>gi|10955104|ref|NP_059760.1| hypothetical protein pTi_088 [Agrobacterium tumefaciens]
MTQLRSHPRLVRKLQDSLGDQLCVALDDATVVEIMLNPDGRLFIERLGHGVVAAGAMTPAAAEVVIGSVA
HALQSEADDERPIISGELPIGGHRFEGLLPPIVSGPAFTIRRRASRLIPLDDYVTSKVMTEAQASAIRSA
IDSRMNIVISGGTGSGKTTLANAIIAEIVTAAPDDRLVILEDTAEIQCAAENAVSLHTSDTVDMARLLKS
TMRLRPDRIIVGEVRDGAALTLLKAWNTGHPGGVTTIHSNTALSALRRLEQLTAEASQQLMQEVIGEAVD
LIVSIERSGKGRRVREVIHIEGYRNNHYQTEHYAQIEEDSHVA
 
Nucleotide Sequence: 972 bp     [Download]
>gi|10955016|ref|NC_002377.1|:c106317-105346 Agrobacterium tumefaciens plasmid Ti, complete sequence
GTGACCCAGCTTCGCTCCCATCCGCGCCTTGTCCGCAAACTCCAGGACTCACTCGGCGACCAGCTCTGTG
TCGCCCTTGACGATGCGACGGTGGTCGAGATCATGCTCAATCCCGATGGTAGACTGTTTATCGAGCGGCT
CGGGCACGGCGTAGTAGCCGCTGGCGCAATGACGCCCGCCGCCGCCGAAGTCGTGATCGGCAGCGTCGCC
CACGCCCTGCAGTCCGAGGCTGACGACGAGCGGCCCATCATATCCGGCGAATTGCCGATCGGCGGCCACC
GTTTCGAAGGTCTGTTGCCGCCGATTGTATCCGGGCCGGCATTTACGATTCGGCGCAGGGCATCGCGCCT
CATACCTCTCGACGATTATGTGACATCGAAAGTGATGACCGAAGCGCAAGCCTCCGCCATCCGCAGCGCA
ATCGATTCCCGCATGAACATAGTCATCTCCGGTGGAACCGGTTCGGGCAAGACGACGCTTGCCAATGCCA
TCATTGCCGAGATCGTCACGGCAGCTCCGGACGATCGCTTGGTCATTCTGGAAGACACCGCCGAAATCCA
GTGCGCCGCCGAGAACGCCGTCTCACTGCATACCAGCGATACGGTCGACATGGCTCGCCTCCTCAAGAGT
ACGATGCGCCTGCGTCCCGACCGCATCATTGTCGGGGAGGTCCGGGACGGCGCCGCACTGACCCTGCTGA
AGGCCTGGAACACCGGCCATCCCGGCGGTGTCACCACGATCCATTCCAACACCGCGTTGTCGGCGCTGCG
TCGGCTGGAGCAACTGACGGCGGAAGCCAGCCAGCAGCTGATGCAGGAGGTGATCGGCGAAGCCGTCGAT
CTCATCGTCTCCATCGAACGCTCGGGGAAGGGGAGGCGGGTCCGCGAGGTCATCCATATCGAAGGATACC
GCAACAACCACTACCAGACCGAACATTACGCCCAGATCGAAGAGGACAGCCATGTCGCTTAA
 Primer design