SecReT4
Protein ID: 10955149
T4SS name [ID]VirB [7]
Gene symbolvirB7
Locus tagpTi_133
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]156721..156888 [+]
Producttype IV secretion system lipoprotein VirB7
Component typeVirB7
UniProt IDP0A3W5, P0A3W4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 55 a.a.     [Download]
>gi|10955149|ref|NP_059805.1| hypothetical protein pTi_133 [Agrobacterium tumefaciens]
MKYCLLCLVVALSGCQTNDTIASCKGPIFPLNVGRWQPTPSDLQLRNSGGRYDGA
 
Nucleotide Sequence: 168 bp     [Download]
>gi|10955016|ref|NC_002377.1|:156721-156888 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGAAATATTGCCTGCTGTGCCTAGTTGTCGCTTTGAGCGGCTGCCAGACAAATGACACAATAGCGAGCT
GCAAAGGCCCGATTTTCCCGCTGAATGTGGGGCGATGGCAGCCTACTCCGTCAGATCTTCAGCTCCGCAA
TTCGGGTGGACGCTATGACGGGGCCTGA
 Primer design