SecReT4
Protein ID: 10955150
T4SS name [ID]VirB [7]
Gene symbolvirB8
Locus tagpTi_134
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]156896..157588 [+]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDQ7BLQ0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-45, Aligned region: 16..220
Protein Sequence: 230 a.a.     [Download]
>gi|10955150|ref|NP_059806.1| hypothetical protein pTi_134 [Agrobacterium tumefaciens]
MLVARESLAEHYKEVEAFQTARAKSARRLSKIIAAVAAIAILGNVAQAFAIATMVPLSRLVPVYLWIRPD
GTVDSEVSISRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPTVRQDYQQFFNYPNPSS
PQVILGKRGRVEVEHIASNDVTPSTQQIRYKRTLVVDGKMPVVSTWTATVRYEKVTSLPGRLRLTNPAGL
VVTSYQTSEDTVSNVGQGAP
 
Nucleotide Sequence: 693 bp     [Download]
>gi|10955016|ref|NC_002377.1|:156896-157588 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGCTAGTGGCGCGCGAAAGCCTGGCCGAGCACTATAAGGAAGTAGAAGCCTTTCAAACCGCGCGAGCGA
AATCGGCGCGACGTCTCTCCAAAATCATTGCAGCTGTCGCGGCTATCGCGATTTTGGGGAATGTTGCTCA
AGCGTTCGCTATAGCTACCATGGTGCCGTTGAGCAGGCTTGTGCCCGTATATCTATGGATACGGCCGGAC
GGCACCGTTGACAGCGAGGTGTCTATCTCGCGATTGCCTGCAACTCAAGAGGAGGCCGTCGTTAACGCTT
CATTGTGGGAGTACGTTCGCCTGCGTGAGAGTTATGATGCCGATACCGCTCAGTACGCCTACGACCTAGT
ATCGAACTTCAGTGCCCCAACAGTGCGCCAGGATTACCAGCAATTCTTCAACTATCCCAATCCCAGTTCG
CCTCAAGTCATTCTTGGCAAACGCGGCAGGGTGGAGGTCGAGCACATCGCTTCAAATGATGTAACTCCAA
GCACGCAGCAAATTCGCTATAAAAGGACCCTCGTCGTTGACGGCAAAATGCCTGTGGTGAGTACGTGGAC
CGCGACAGTTCGCTACGAAAAGGTGACCAGCTTGCCCGGCAGATTGAGATTGACCAACCCGGCAGGTCTG
GTTGTCACCTCCTATCAGACCTCGGAAGATACCGTTTCAAACGTAGGCCAGGGCGCACCATGA
 Primer design