SecReT4
Protein ID: 10955153
T4SS name [ID]VirB [7]
Gene symbolvirB11
Locus tagpTi_137
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]159636..160667 [+]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDQ7BLP8, P0A3F8, P0A3F9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.3e-58, Aligned region: 12..310
Protein Sequence: 343 a.a.     [Download]
>gi|10955153|ref|NP_059809.1| hypothetical protein pTi_137 [Agrobacterium tumefaciens]
MEVDPQLRFLLKPILEWLDDPKTEEIAINRPGEAFVRQAGIFTKMPLPVSYDDLEDIAILAGALRKQDVG
PRNPLCATELPGGERLQICLPPTVPSGTVSLTIRRPSSRVSGLKEVSSRYDASRWNQWQTRRKRQNQDDE
AILQHFDNGDLEAFLHACVVSRLTMLLCGPTGSGKTTMSKTLISAIPPQERLITIEDTLELVIPHDNHVR
LLYSKNGAGLGAVSAEHLLQASLRMRPDRILLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPIQGFKKL
FSLVKSSVQGASLEDRTLIDMLSTAIDVIIPFRAYEDVYEVGEIWLAADARRRGETIGDLLNQ
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|10955016|ref|NC_002377.1|:159636-160667 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGGAAGTGGATCCGCAACTACGCTTTCTTCTGAAGCCGATTTTGGAATGGCTCGATGACCCGAAGACTG
AAGAAATTGCGATCAATCGACCTGGAGAGGCATTTGTGCGCCAAGCCGGCATTTTTACCAAGATGCCTTT
ACCCGTCTCTTATGATGATCTTGAAGATATCGCTATTTTAGCGGGCGCGCTGAGAAAGCAGGATGTCGGA
CCACGTAACCCCCTCTGCGCCACTGAACTTCCTGGTGGTGAACGGCTACAAATCTGTCTGCCGCCGACCG
TTCCCTCGGGCACCGTCAGCTTGACCATTCGACGGCCAAGCTCCCGTGTTTCTGGTCTTAAAGAAGTCTC
CTCCCGTTATGATGCTTCGAGGTGGAACCAGTGGCAGACACGAAGGAAACGCCAAAATCAGGATGATGAA
GCTATCCTTCAGCATTTTGACAACGGGGATTTGGAAGCGTTTCTGCACGCATGCGTCGTCAGCCGACTGA
CGATGTTGCTATGTGGCCCTACCGGAAGCGGCAAGACAACAATGAGCAAGACCTTGATCAGCGCCATCCC
ACCCCAGGAAAGGCTAATCACCATAGAAGATACGCTCGAACTCGTCATTCCACATGATAATCATGTTAGA
CTACTCTACTCAAAGAACGGTGCTGGGCTGGGTGCCGTGAGCGCCGAGCACTTGCTCCAAGCAAGTCTAC
GTATGCGACCGGACCGGATATTGCTGGGCGAGATGCGCGACGATGCAGCATGGGCTTATCTGAGTGAAGT
CGTCTCGGGACATCCGGGATCGATTTCAACAATACACGGCGCGAATCCCATCCAAGGATTCAAGAAGCTG
TTTTCCCTTGTGAAAAGTAGCGTCCAAGGTGCTAGCTTGGAAGATCGCACACTGATTGACATGCTCTCTA
CGGCGATCGATGTTATTATTCCATTCCGTGCCTATGAGGACGTTTATGAAGTAGGCGAGATCTGGCTCGC
GGCGGACGCACGACGCCGGGGCGAGACCATAGGCGATCTCCTAAATCAATAG
 Primer design