SecReT4
Protein ID: 10955160
T4SS name [ID]VirB [7]
Gene symbolvirD4
Locus tagpTi_144
StrainAgrobacterium tumefaciens plasmid Ti (NC_002377)
Repliconplasmid Ti [GenBank: NC_002377] [Browse all T4SS(s) in this replicon]
Location [Strand]170649..172619 [+]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDP09817, Q8VLK3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 8.6e-159, Aligned region: 97..538
TraG-D_C [PF12696], Evalue: 1.2e-27, Aligned region: 391..509
TrwB_AAD_bind [PF10412], Evalue: 1.6e-22, Aligned region: 137..521
AAA_10 [PF12846], Evalue: 1.7e-06, Aligned region: 140..467
Protein Sequence: 656 a.a.     [Download]
>gi|10955160|ref|NP_059816.1| hypothetical protein pTi_144 [Agrobacterium tumefaciens]
MNSSKTSPQRMTLSIVCSLAAGFCAASCYVTFRRGFNGEAIMTFDVFAFWYETPLYLGYASTVFWRGLSV
VIFTSLAVLSSQLIISLRNQKHHGTARWAEIGEMQHAGYLQRYSRIKGPIFGKTCGPLWFGSYLTNGEQP
HSLVVAPTRAGKGVGIVIPTLLTFKGSVIALDVKGELFELTSRARKASGDAVFKFSPLDSERKTHCYNPV
LDIATLPPERQFTETRRLAANLITAKGKGAEGFIDGARDLFVAGILTCIERGTPTIGAVYDLFAQPGEKY
KLFAQLAEESLNKEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWADPLIKAATSRSDFSVYDLRRKKTC
IYLCVSPNDLEVLAPLMRLLFQQLVSILQRSLPGKDECHEVLFLLDEFKHLGKLEAIETAITTIAGYKGR
FMFIIQSLSALTGTYDDAGKQNFLSNTGVQVFMATADDETPTYISKAIGEYTFKARSTSYSQASMFDHNI
QISDQGAALLRPEQVRLLDDQSEIVLIKGRPPLKLRKVQYYSDRTLKRLFERQMGSLPEPAPLMLSDYSN
DQVQSHLAEIANFNEDAAPRNRTVAEDHGSVKVGADIPERVMGINGDEDQADAREIPPESVVPPELTLAL
AAQQQLLDQIIALQQRSRSAPAQPAK
 
Nucleotide Sequence: 1971 bp     [Download]
>gi|10955016|ref|NC_002377.1|:170649-172619 Agrobacterium tumefaciens plasmid Ti, complete sequence
ATGAATTCCAGCAAGACTTCGCCCCAGCGAATGACCCTGAGCATCGTATGTTCGCTGGCAGCCGGTTTTT
GTGCGGCCAGCTGCTATGTAACGTTTCGCCGGGGCTTCAATGGCGAAGCGATCATGACGTTTGACGTTTT
CGCTTTTTGGTATGAGACCCCGCTTTACTTGGGTTATGCCAGCACCGTCTTCTGGCGTGGTTTATCTGTT
GTCATCTTTACCTCGCTGGCTGTTCTTTCAAGTCAGCTCATCATATCGCTGCGCAATCAGAAGCATCACG
GGACGGCTCGTTGGGCAGAAATTGGCGAAATGCAGCATGCTGGTTATCTGCAGCGTTACAGTCGCATCAA
GGGGCCGATCTTTGGAAAGACATGTGGTCCTCTTTGGTTCGGCAGTTATTTGACCAATGGCGAACAGCCA
CACAGTCTTGTCGTCGCGCCAACGCGTGCTGGCAAAGGCGTCGGCATCGTCATTCCAACGCTTTTGACCT
TCAAGGGCTCGGTAATCGCCCTCGACGTCAAGGGAGAATTGTTTGAACTGACATCCAGAGCACGCAAAGC
GAGCGGCGACGCAGTTTTCAAGTTTTCCCCCCTAGATTCTGAGCGGAAGACTCATTGTTACAATCCGGTC
CTGGATATTGCCACACTTCCGCCCGAACGCCAGTTCACTGAAACACGCCGTCTTGCTGCGAACCTTATTA
CGGCTAAGGGAAAGGGAGCAGAAGGCTTTATTGACGGCGCACGTGACCTGTTCGTTGCGGGAATCCTTAC
TTGCATTGAGCGTGGCACACCAACTATTGGCGCGGTATATGACCTATTTGCGCAGCCTGGCGAAAAGTAT
AAGCTTTTTGCGCAACTCGCGGAGGAAAGCCTAAACAAAGAGGCTCAGCGTATCTTCGATAACATGGCGG
GCAACGACACGAAAATTCTGACATCGTACACCTCTGTGCTGGGCGACGGTGGACTGAACCTCTGGGCTGA
TCCGCTTATCAAAGCAGCGACAAGCCGGTCAGATTTTTCCGTTTACGATCTCCGGAGGAAGAAGACCTGC
ATTTATCTTTGTGTCAGTCCCAACGATCTGGAGGTCCTGGCACCACTTATGCGCCTGCTGTTTCAGCAGC
TCGTGTCAATCTTGCAGAGATCGCTGCCAGGTAAAGACGAGTGCCATGAAGTTTTATTTCTCCTCGACGA
ATTCAAGCACCTGGGCAAGCTTGAGGCCATAGAGACCGCGATCACAACCATCGCCGGTTACAAAGGCCGC
TTTATGTTTATTATTCAAAGTCTTTCGGCCTTGACGGGCACATACGATGACGCAGGAAAACAAAACTTTC
TGAGCAATACTGGCGTGCAAGTATTTATGGCCACGGCTGACGACGAGACCCCAACCTACATCTCAAAAGC
TATCGGCGAATATACGTTTAAAGCGCGTTCGACCTCTTACAGTCAAGCCAGCATGTTCGACCACAACATC
CAGATTTCTGATCAAGGTGCAGCCCTTTTGCGCCCCGAACAAGTGCGCCTGCTAGACGATCAGAGTGAAA
TCGTTCTCATCAAAGGGCGACCTCCACTCAAATTACGAAAGGTACAATATTATTCCGATCGTACGCTGAA
ACGGCTTTTTGAACGCCAGATGGGCTCTCTGCCTGAGCCCGCACCCTTGATGCTTTCCGACTATAGCAAC
GATCAAGTTCAATCCCACTTGGCTGAGATAGCAAATTTCAATGAGGATGCTGCACCGCGAAACAGAACTG
TGGCCGAGGACCATGGAAGTGTTAAAGTCGGTGCTGATATCCCTGAACGCGTGATGGGAATAAATGGTGA
CGAGGACCAAGCCGATGCGCGTGAGATACCGCCGGAATCGGTTGTGCCTCCCGAATTGACGCTGGCTCTG
GCCGCTCAACAGCAATTGTTGGACCAGATTATTGCACTTCAGCAAAGATCGAGGTCCGCACCGGCACAGC
CTGCGAAATGA
 Primer design