SecReT4
Protein ID: 10955212
T4SS name [ID]Trb [49]
Gene symboltrbC
Locus tagR751p31
StrainEnterobacter aerogenes plasmid R751 (NC_001735)
Repliconplasmid R751 [GenBank: NC_001735] [Browse all T4SS(s) in this replicon]
Location [Strand]18597..19061 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDP71178
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.9e-18, Aligned region: 12..110
Protein Sequence: 154 a.a.     [Download]
>gi|10955212|ref|NP_044241.1| hypothetical protein R751p31 [Enterobacter aerogenes]
MQATFPAFRLNRNALFYMGLFALLAFFLLAPQHAFASEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFLRTLIFIVLVMGLLVGAQNMMSTFFGRGAEIAALTDGALHQVKVAALDVAGFPG
EAVMRWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|113911681|ref|NC_001735.4|:18597-19061 Enterobacter aerogenes plasmid R751, complete sequence
ATGCAAGCAACCTTCCCGGCATTCCGCCTCAACCGCAACGCCCTGTTCTACATGGGCCTCTTCGCCCTCC
TGGCGTTCTTCCTGCTGGCCCCCCAGCACGCATTCGCCTCCGAGGGCACCGGCGGCTCTCTGCCGTATGA
GAGCTGGCTGACCAACCTCCGCAACTCCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTGGTCGCCGGCGGCATCCTCATCTTCGGCGGCGAACTCAACGGCTTCTTGCGCACGTTGATCTTCATCG
TCCTGGTCATGGGCCTGCTGGTCGGCGCGCAGAACATGATGAGCACGTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGCGCTGCACCAGGTCAAGGTCGCCGCGCTGGACGTGGCCGGCTTCCCCGGC
GAAGCCGTCATGCGCTGGGCCGAGCGCGGCCACATCGCGGGGTAA
 Primer design