SecReT4
Protein ID: 10955221
T4SS name [ID]Trb [49]
Gene symboltrbL
Locus tagR751p40
StrainEnterobacter aerogenes plasmid R751 (NC_001735)
Repliconplasmid R751 [GenBank: NC_001735] [Browse all T4SS(s) in this replicon]
Location [Strand]26578..28296 [+]
ProductTrbL
Component typeTrbL
UniProt IDP71187
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.6e-38, Aligned region: 65..279
Protein Sequence: 572 a.a.     [Download]
>gi|10955221|ref|NP_044250.1| TrbL [Enterobacter aerogenes]
MRMPANLKTLALPLFVWLAFFAVDAHAAIDNAGVFDSVLDRYQTAASGWAGVITTAATWLFWTLVVISMV
WTFGMMALRKADIGEFFAEFVRFTIFTGFFWWALTNGPNFASSIYASLRQLAGNATGLGNALSPSGIVDV
GFAIFDKVMDQSSVWSPVDSMAGILMAVAILVILALVGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDM
AINYYKVVLGVAAQLFAMVLLVGIGKTFLDDYYSRMSAGISLKEMGVMLIVVIILLALVNKIPPLIAGII
TGASVGGAGIGQFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSAGTDVMSA
FSGGGSSGGGAGGGGDAGTGSTPFAQAAGFSGSSGGGSSSGGGSPSTGSSSGSSKGGDKGGGKADAGGQG
SSSTASTGSSADKAAKNEPKPAGGAGQGQQAAPGSTGPGLLASAASALGTAGRIAADAGANLAKGTADVA
KAKAASLREAAAERIADTTGGKIAAAIKAQGSGTAENIDVPDQQPAPSFGDNRLAGGPADADPESEVAAF
ANREQGRDGTTA
 
Nucleotide Sequence: 1719 bp     [Download]
>gi|113911681|ref|NC_001735.4|:26578-28296 Enterobacter aerogenes plasmid R751, complete sequence
ATGAGAATGCCAGCCAATCTAAAAACCCTCGCCCTGCCGCTGTTCGTCTGGCTGGCGTTCTTCGCGGTCG
ATGCCCACGCGGCCATCGACAACGCCGGCGTGTTCGATAGCGTGCTGGATCGCTACCAGACCGCCGCGAG
CGGCTGGGCCGGTGTCATCACCACGGCCGCAACCTGGCTCTTCTGGACGCTGGTTGTGATCTCGATGGTC
TGGACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGCGAGTTCTTCGCGGAGTTCGTCCGCTTCA
CGATCTTTACCGGCTTCTTCTGGTGGGCGCTGACCAACGGCCCTAACTTCGCCTCGTCCATCTATGCGTC
GTTGCGGCAGCTCGCCGGCAACGCGACGGGCCTGGGCAATGCTCTGTCGCCCTCGGGGATCGTGGACGTG
GGCTTTGCGATCTTCGACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCA
TCCTCATGGCCGTGGCGATCCTGGTCATCCTGGCCCTGGTCGGTGTGAATATGCTTCTGCTGCTCGCGTC
GGGCTGGGTGCTCGCCTACGGCGGCGTGTTCTTCCTCGGCTTCGGTGGTTCGCGCTGGACTTCCGACATG
GCGATCAACTACTACAAGGTCGTCCTGGGCGTGGCCGCGCAGCTCTTCGCAATGGTGCTCCTGGTGGGCA
TCGGCAAGACCTTCCTCGATGACTACTACTCGCGCATGAGCGCCGGCATCAGCCTCAAGGAAATGGGCGT
GATGCTGATCGTCGTCATCATCCTCTTGGCGTTGGTCAACAAGATTCCGCCGCTCATCGCCGGGATCATC
ACCGGCGCGAGCGTGGGCGGTGCCGGCATCGGCCAGTTCGGTGCAGGCGCTGCGTTGGGTGCCGCAGGCA
TGGCAGCAGCAGCGGCCGCGACCGGCGGCGCCGCTCTGGCCGCCGGCGCAGCCTCGGCCGCCGGTGGTGC
CTCTGCCGTCATGGCCGCCTTCTCGAAGGCCAATGAGAACGTGTCGGCAGGCACGGACGTTATGTCGGCC
TTCTCGGGCGGCGGCAGCTCGGGCGGCGGTGCGGGCGGCGGCGGCGACGCCGGCACCGGCAGCACGCCCT
TCGCTCAGGCTGCGGGCTTTAGCGGCAGCTCCGGCGGTGGCTCTTCGTCGGGTGGCGGCAGCCCCTCGAC
CGGCAGCAGCTCGGGCAGCTCGAAGGGCGGCGATAAGGGCGGCGGCAAAGCCGACGCCGGCGGCCAGGGC
AGCAGCTCGACGGCCAGCACCGGCAGCAGTGCCGACAAGGCCGCCAAGAACGAACCCAAGCCCGCCGGCG
GGGCAGGGCAAGGGCAGCAGGCCGCACCGGGCAGCACCGGCCCCGGCTTGCTCGCATCGGCCGCATCGGC
CCTCGGCACGGCCGGCCGCATCGCCGCCGACGCCGGCGCGAACTTGGCGAAGGGAACCGCCGATGTTGCC
AAGGCCAAAGCCGCGAGCCTGCGCGAAGCCGCAGCCGAGCGGATCGCCGACACCACTGGCGGAAAGATCG
CCGCCGCGATCAAGGCGCAAGGAAGCGGCACGGCCGAGAACATCGACGTGCCCGACCAGCAGCCCGCGCC
GAGCTTCGGCGACAACAGGCTGGCAGGCGGCCCCGCCGATGCCGATCCCGAGTCCGAAGTAGCTGCGTTC
GCCAACCGCGAGCAAGGCCGCGACGGCACAACTGCGTAA
 Primer design