SecReT4
Protein ID: 10955504
T4SS name [ID]VirB [412]
Gene symboltraK
Locus tagR721_65
StrainEscherichia coli plasmid R721 (NC_002525)
Repliconplasmid R721 [GenBank: NC_002525] [Browse all T4SS(s) in this replicon]
Location [Strand]54506..56464 [-]
Productconjugal transfer protein TraK
Component typeVirD4
UniProt IDQ9F531
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.3e-86, Aligned region: 127..591
TraG-D_C [PF12696], Evalue: 3.8e-25, Aligned region: 427..551
TrwB_AAD_bind [PF10412], Evalue: 4e-16, Aligned region: 221..277
TrwB_AAD_bind [PF10412], Evalue: 4e-16, Aligned region: 341..554
Protein Sequence: 652 a.a.     [Download]
>gi|10955504|ref|NP_065356.1| conjugal transfer protein TraK [Escherichia coli]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQEAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
 
Nucleotide Sequence: 1959 bp     [Download]
>gi|10955438|ref|NC_002525.1|:c56464-54506 Escherichia coli K-12 plasmid R721, complete sequence
ATGGATGCAAAAAAGACGGGGGGGTTAATTCTCTTCCTGTTACTGCTTCTTGTGGGTGTGCTTATAGCCT
CAAACTATCTCGGTGGATACACAGCATTAAGATATTCATCCGTTGATATGTCTTTGCTCAAGTGGGATAC
ATTCCATTCTGTAATCTCAACATTTTCTGGCAACCCACAATATAAAAAACTCGTTTTTATGGCATGGTTT
GGATTCAGCGTTCCATTAATATTCTTTGCCATATTCATGTTGATTGTCGTGATTGGGATTATGCCTAAAA
AAGTCATCTACGGTGACGCCCGGCTCGCAACTGATATGGACCTGAGTAAATCAGGTTTTTTCCCGGATAA
AAAATCACCTTACAAACATCCACCAATACTCATCGGTAAAATGTTCAAGGGGAGATACAAAAAACAATTT
ATTTATTTCGCCGGACAACAATTTTTAATTCTTTATGCCCCGACACGTTCTGGTAAAGGGGTGGGGATTG
TTATCCCCAACTGCGTAAACTATCCAGGAAGTATGGTCATACTGGATATCAAACTTGAAAACTGGTTTTT
ATCAGCCGGATTCAGGCAAAAAGAATTAGGGCAAGAATGCTTTCTCTTTGCGCCAGCCGGATACGCGGAA
ACTATCGACCAGGCCATTAAAGGACAGATACGCTCTCACCGCTGGAATCCTCTTGATTGCGTCAGTCGCA
GTGATTTACTTCGTGAAACGGACCTGGCAAAAATTGCTGCAATCCTTATCCCGGCAAGTGATGATCCTAT
ATGGTCTGATTCTGCACGAAACCTTTTTGTCGGGTTAGGACTTTACCTGCTGGACAAGGAGCGTTTTCAC
CTGGAACAGGAAGCCAAAGGTCATAATGTACCGGACGTTCTTGTTTCCATCAGCGCCATACTGAAAACGT
CGGTTCCCGATGGCGGTAAGGATCTCGCCGCATGGATGGGACAGGAAATTGAAAACCGTAGCTGGATTAG
CGATAAAACAAAATCATTCTTCTTTAAGTTCATGTCAGCACCAGATCGCACAAGGGGAAGTATAGAAACA
AACTTTTCATCACCGTTGAGCATCTTCAGCAACCCTATTACTGCTGAGGCGACGAATTTCAGTGATTTTG
ATATCCGGGATATTCGTAAAAAGCCCATGTCAATTTATCTTGGTCTGACACCGGATGCTTTAATCACTCA
TGAGAAAATTGTAAACCTTTTCTTCTCATTACTGGTTAATGAAAACTGTCGTGAACTACCGGAACACAAC
CCGGACCTGAAATACCAGTGTCTTATTCTCCTGGATGAATTTACATCAATGGGTAAATCGGAGGTCATTG
AACGCGCTGTTGGTTTTACAGCAGGTTATAACCTTCGCTTTATGTTCATTCTTCAGAATGAAGGACAAGG
GCAAAAAAGCGATATGTACGGTCAGGAAGGATGGACCACATTCACTGAAAACAGTGCTGTTGTGCTTTAC
TATCCGCCGAAATCAAAAAATGCTCTGGCTAAAAAGATTTCAGAAGAGATTGGGGTGCGTGATATGAAAA
TATCCAAACGCTCAATATCCAGTGGTGGTGGTAAGGGAGGAAGTTCACGTACACGGAATGATGATGTAAT
AGAGCGCCCGGTTCTTCTTCCTGAAGAAATTGTGTCTCTCCGGGATAAGAAGAATAAAGCCAGAAATATT
GCAATCCGTGAAATTATAACCAGTGAATTTAGCCGACCATTTATTGCCAACAAAATAATCTGGTTTGAAG
AACCAGAGTTTAAACGCCGCGTGGATATCGCCCGTAACAATCATGTTGACATTCCAAACCTGTTTACACA
AGAAGTCATGGATGAAATAGCAAAAATTGCAGAAATTTATCTCCCTAAAGCTGGAGGAAAAAAAGTCATG
GTTGCCGGAGGCAATGTGATTACTAATCCAGACCTTGATAATCACGATAAAACAGACGTATCTGAATAA
 Primer design