SecReT4
Protein ID: 10955505
T4SS name [ID]VirB [412]
Gene symboltraJ
Locus tagR721_66
StrainEscherichia coli plasmid R721 (NC_002525)
Repliconplasmid R721 [GenBank: NC_002525] [Browse all T4SS(s) in this replicon]
Location [Strand]56480..57535 [-]
Productconjugal transfer protein TraJ
Component typeVirB11
UniProt IDQ9F530
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.3e-63, Aligned region: 29..327
G-alpha [PF00503], Evalue: 8.1e-05, Aligned region: 169..258
AAA_17 [PF13207], Evalue: 9.9e-05, Aligned region: 187..230
Protein Sequence: 351 a.a.     [Download]
>gi|10955505|ref|NP_065357.1| conjugal transfer protein TraJ [Escherichia coli]
MNNIRDTSNTSQPRDNSKTARRYLDMTGIQSVLNIEHVTEISVNKPGTIWFEGKNGWESKDAPDATFDNL
MTLAKTLTNLSKIKIPLSHDNPIASVVLPGGERGQIIIPPATENNSVVISIRKPSLTRFTIDDYVRTGRF
DNVRIATKHEAILTERQRYLYELSRRPDGQSKAQFLREAVKDRLNFLIVGGTGSGKTTIAKAIADIFPPE
RRYITVEDVPEMSLPLHPNHIRLFYKKNTVEAKEIIEACMRLKPDHIFLAELRGNEAWSYLEALNTGHEG
SISTIHANNTYASFSRLASIVKQSDVGMTVDMDLIMRTIKTSIDVILFFNHTRMTELYYEPEEKNRFLST
M
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|10955438|ref|NC_002525.1|:c57535-56480 Escherichia coli K-12 plasmid R721, complete sequence
ATGAATAACATCAGAGATACCAGTAATACATCACAACCACGAGATAACAGTAAAACCGCAAGACGATATC
TGGATATGACGGGTATCCAGTCTGTTCTTAATATTGAACATGTCACAGAAATATCTGTGAATAAACCAGG
AACAATATGGTTTGAAGGGAAAAATGGCTGGGAATCTAAAGATGCGCCAGACGCGACTTTTGATAATTTA
ATGACACTTGCCAAAACTCTGACGAACTTATCAAAGATAAAAATACCACTTAGCCATGATAATCCCATTG
CATCGGTAGTTCTTCCCGGTGGGGAACGTGGACAAATCATCATTCCACCTGCAACAGAAAATAACAGCGT
TGTGATATCTATCCGTAAGCCATCATTAACGCGCTTTACTATAGATGATTATGTCCGAACAGGGCGTTTT
GATAATGTCAGAATTGCGACGAAACACGAAGCCATCCTGACTGAACGGCAACGCTACCTGTATGAATTAT
CCCGACGTCCAGATGGTCAATCTAAAGCTCAATTTTTAAGAGAGGCAGTTAAAGACCGTCTTAATTTTTT
AATCGTAGGTGGGACTGGCTCCGGTAAGACAACTATAGCAAAGGCAATTGCAGATATCTTTCCACCTGAA
CGGCGTTATATAACCGTTGAAGATGTACCGGAAATGTCTCTGCCGCTGCATCCAAACCACATCCGGCTTT
TCTACAAAAAAAATACCGTTGAAGCGAAGGAAATCATTGAAGCGTGTATGCGATTAAAGCCAGATCACAT
CTTTCTTGCTGAACTTAGGGGTAACGAAGCATGGAGTTATCTGGAGGCGCTTAATACAGGGCATGAAGGC
TCAATCAGTACCATTCATGCTAATAATACTTATGCCTCATTTTCACGACTGGCAAGTATTGTAAAACAAT
CTGATGTTGGTATGACTGTTGATATGGACCTCATCATGCGCACGATAAAAACATCAATTGATGTCATTCT
TTTTTTCAACCATACCAGAATGACTGAACTGTATTACGAACCCGAAGAAAAAAATCGCTTTTTGAGCACA
ATGTAA
 Primer design