SecReT4
Protein ID: 10955508
T4SS name [ID]VirB [412]
Gene symboltraG
Locus tagR721_69
StrainEscherichia coli plasmid R721 (NC_002525)
Repliconplasmid R721 [GenBank: NC_002525] [Browse all T4SS(s) in this replicon]
Location [Strand]59610..60344 [-]
Productconjugal transfer protein TraG
Component typeVirB8
UniProt IDQ9F527
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.5e-58, Aligned region: 32..241
Protein Sequence: 244 a.a.     [Download]
>gi|10955508|ref|NP_065360.1| conjugal transfer protein TraG [Escherichia coli]
MENTNYYEHSKKEATKKKFEEKNEKKDYFKAIRDFERSEIEIIKKKAKTFTILAIGEFVVICILGFAIAS
LAPLKTAVPFLVRVDNSTGYTDIAPQLSDAKESYQDVETKYFLSKYLINYEAYDWQTIQEQADTVKTMSS
QKVFSAYDTMIRADSSPLNILKNNYKIKVQINSVILLRKDMAQVRFKKMVLDLSGKPAPGYRATEWISTI
SFDWDKDIKTEKERLVNPLGLQVLSYQPDPEVIK
 
Nucleotide Sequence: 735 bp     [Download]
>gi|10955438|ref|NC_002525.1|:c60344-59610 Escherichia coli K-12 plasmid R721, complete sequence
ATGGAAAACACAAACTATTATGAACATTCAAAAAAAGAAGCCACCAAAAAGAAATTTGAAGAAAAAAACG
AAAAAAAGGATTATTTCAAGGCCATACGTGACTTTGAGCGCAGTGAAATTGAAATCATAAAGAAAAAGGC
AAAAACATTTACCATTCTCGCCATTGGTGAATTTGTTGTAATTTGCATTCTTGGTTTCGCAATAGCCTCT
CTTGCTCCATTAAAAACCGCTGTACCGTTCCTTGTGCGAGTGGATAACAGCACTGGATATACTGATATTG
CCCCTCAATTATCTGATGCTAAGGAAAGTTATCAGGATGTTGAGACTAAATATTTCCTGTCAAAATATCT
CATTAACTATGAAGCATACGACTGGCAGACCATCCAGGAACAGGCCGATACAGTAAAAACAATGTCTTCC
CAAAAGGTGTTTTCAGCTTATGACACCATGATTCGTGCTGATTCCTCACCACTGAACATTCTGAAAAACA
ACTACAAAATTAAGGTCCAGATTAATTCAGTAATCCTTCTAAGGAAGGATATGGCGCAGGTGCGTTTCAA
AAAAATGGTACTGGATTTATCTGGTAAACCCGCCCCCGGATACAGAGCAACAGAGTGGATTTCGACGATT
TCTTTTGACTGGGATAAAGATATCAAAACAGAAAAAGAGCGCCTTGTGAATCCGCTGGGACTGCAAGTTC
TGAGCTACCAACCTGATCCAGAGGTTATAAAATGA
 Primer design