SecReT4
Protein ID: 10955509
T4SS name [ID]VirB [412]
Gene symboltraF
Locus tagR721_70
StrainEscherichia coli plasmid R721 (NC_002525)
Repliconplasmid R721 [GenBank: NC_002525] [Browse all T4SS(s) in this replicon]
Location [Strand]60344..60478 [-]
Productconjugal transfer lipoprotein TraF
Component typeVirB7
UniProt IDQ9F526
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 44 a.a.     [Download]
>gi|10955509|ref|NP_065361.1| conjugal transfer lipoprotein TraF [Escherichia coli]
MKIPLIIASALLISACSHTPNPVQKKGGWFELNTAIEQIKAGDY
 
Nucleotide Sequence: 135 bp     [Download]
>gi|10955438|ref|NC_002525.1|:c60478-60344 Escherichia coli K-12 plasmid R721, complete sequence
ATGAAAATCCCCCTCATAATTGCCTCCGCGCTATTAATTAGTGCATGTTCTCACACCCCCAATCCTGTGC
AGAAAAAAGGGGGATGGTTTGAGTTAAACACAGCAATTGAACAGATCAAAGCAGGTGATTATTAA
 Primer design