SecReT4
Protein ID: 10956723
T4SS name [ID]VirB [188]
Gene symbol-
Locus tagXFa0012
StrainXylella fastidiosa 9a5c
Repliconplasmid pXF51 [GenBank: NC_002490] [Browse all T4SS(s) in this replicon]
Location [Strand]9150..9971 [+]
Productconjugal transfer protein
Component typeVirB8
UniProt IDQ9PHJ3
KEGG IDxfa:XFa0012
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.1e-66, Aligned region: 16..224
Protein Sequence: 273 a.a.     [Download]
>gi|10956723|ref|NP_061668.1| conjugal transfer protein [Xylella fastidiosa 9a5c]
MKSNVDKKDFDNYLKEARTWETDKVHDLLKSRKTAWWVAGASAAIAFVAVLAVAALTPLKTTEPYVIRVN
NNTGAVDVVKAMKEGKTNYDEAINKYFVQWYVRYRESYSRELAEDYYSYVGIFSNDVEQQKYSAAFNPKN
PQSPLNIYGTYAKVKIDIQSTSFIHSNVALVRYTKKVERGLDQPQITHWLATITFKYLNTPMKEKDRGIN
PLGFQVSEYRNDPDAAVNNINTPDNNGQTAPQIVTPAEAVPGVAAFPSATTPAPVPVVPSVKQ
 
Nucleotide Sequence: 822 bp     [Download]
>gi|10956711|ref|NC_002490.1|:9150-9971 Xylella fastidiosa 9a5c plasmid pXF51, complete sequence
ATGAAAAGCAATGTCGATAAAAAAGACTTCGATAACTACTTGAAGGAAGCGCGCACCTGGGAAACCGATA
AGGTGCATGACCTGTTGAAGTCTCGCAAAACCGCCTGGTGGGTGGCTGGCGCTTCCGCTGCCATTGCCTT
TGTCGCTGTCCTTGCTGTTGCCGCGCTGACACCATTGAAGACTACGGAACCCTACGTTATCCGCGTGAAT
AACAACACGGGCGCGGTCGATGTGGTAAAGGCCATGAAGGAAGGCAAGACAAACTACGACGAGGCCATAA
ACAAGTATTTTGTTCAATGGTACGTCCGCTATCGTGAAAGCTATTCAAGAGAACTGGCCGAAGATTACTA
CTCGTATGTTGGTATCTTTTCTAACGACGTTGAACAGCAAAAGTATTCTGCTGCGTTTAATCCGAAAAAC
CCGCAATCGCCGCTGAATATCTATGGCACTTACGCCAAGGTCAAGATTGATATTCAAAGCACCTCGTTCA
TCCATTCAAATGTCGCCTTGGTTCGTTACACCAAGAAGGTAGAACGTGGCCTTGATCAGCCGCAAATCAC
CCATTGGCTCGCGACAATCACATTCAAGTATTTGAACACCCCCATGAAGGAGAAAGACAGGGGAATTAAC
CCGCTTGGCTTCCAAGTATCCGAATACCGCAATGACCCTGATGCAGCGGTAAATAACATCAATACACCGG
ACAACAACGGCCAAACCGCGCCGCAAATCGTTACGCCTGCGGAGGCCGTTCCTGGTGTTGCCGCCTTCCC
CTCTGCAACCACTCCCGCGCCTGTACCTGTAGTGCCTTCCGTTAAACAGTAA
 Primer design