SecReT4
Protein ID: 10956726
T4SS name [ID]VirB [188]
Gene symbol-
Locus tagXFa0015
StrainXylella fastidiosa 9a5c
Repliconplasmid pXF51 [GenBank: NC_002490] [Browse all T4SS(s) in this replicon]
Location [Strand]12146..13189 [+]
Productconjugal transfer protein
Component typeVirB11
UniProt IDQ9PHJ0
KEGG IDxfa:XFa0015
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 9.2e-65, Aligned region: 27..326
Protein Sequence: 347 a.a.     [Download]
>gi|10956726|ref|NP_061671.1| conjugal transfer protein [Xylella fastidiosa 9a5c]
MGEKMTNSTAQKQDDGRSSEMLAEYMEPLRAFLDDTSLNEICVNRPSEVWTEGRNGWQRFDVPCLTFSHC
CKLATLIASYNGKSITANKPVLSAALPGGARVQVVIPPACETRTVSITIRKPSMVDKTLDELEAEGAFDQ
VENVDASGTLHPYEVELLALKKSNRIKEFLKLAMQHGLTLVIVGKTGSGKTTIGKSITNCIPTDERLVTV
EDVHEMFLNHHPNKVHLFYSRDGEGSLSINPKQAIASCLRMKPDRILLTEMRGDEAWEFVKAVGSGHPGI
STAHAGGALEAFDQIVALIKDSATGAHLDAAYIKKRVFETVDIVLYYVHHKLREIYYDPEFKRKQLG
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|10956711|ref|NC_002490.1|:12146-13189 Xylella fastidiosa 9a5c plasmid pXF51, complete sequence
GTGGGTGAAAAAATGACGAATTCGACTGCCCAGAAACAGGATGATGGGCGGTCATCTGAAATGCTCGCCG
AATATATGGAACCTTTGCGGGCGTTCCTTGATGACACAAGCCTGAATGAAATTTGTGTCAATCGCCCCAG
CGAAGTCTGGACAGAAGGGCGCAACGGGTGGCAACGGTTCGATGTTCCCTGCCTGACATTCTCACATTGC
TGCAAGTTGGCAACCCTGATTGCCAGCTACAATGGCAAATCAATCACGGCTAACAAGCCGGTGTTATCGG
CTGCTCTTCCAGGTGGTGCACGTGTCCAGGTCGTCATTCCCCCTGCCTGCGAAACACGCACGGTGTCTAT
CACCATTCGTAAGCCGTCGATGGTGGACAAGACACTTGACGAACTGGAAGCCGAAGGTGCTTTCGATCAG
GTGGAAAACGTTGATGCTTCCGGCACTCTGCACCCGTATGAAGTCGAGTTGCTTGCTCTCAAGAAAAGCA
ATCGCATCAAAGAATTCTTGAAGCTCGCCATGCAGCACGGCTTGACGCTGGTGATTGTTGGAAAAACCGG
CTCGGGCAAAACCACTATCGGAAAAAGCATCACAAATTGCATCCCAACAGATGAACGCCTGGTGACGGTT
GAAGACGTGCATGAAATGTTCTTGAACCATCACCCCAACAAGGTGCATCTGTTCTATTCGCGTGACGGTG
AAGGCAGCTTAAGCATCAACCCGAAGCAAGCCATAGCATCGTGTCTACGGATGAAGCCTGACCGCATTTT
GCTGACGGAAATGCGGGGCGATGAAGCATGGGAATTCGTCAAGGCTGTGGGTTCAGGGCATCCAGGCATC
AGCACGGCACACGCTGGCGGGGCGCTAGAAGCCTTTGACCAGATTGTGGCCCTTATCAAAGATAGTGCTA
CCGGCGCGCATTTGGACGCCGCATATATCAAGAAGCGAGTTTTTGAGACGGTCGATATCGTGCTTTATTA
CGTCCACCACAAACTACGCGAAATCTACTATGACCCTGAATTTAAGCGAAAACAATTGGGTTAA
 Primer design