SecReT4
Protein ID: 10956727
T4SS name [ID]VirB [188]
Gene symbol-
Locus tagXFa0016
StrainXylella fastidiosa 9a5c
Repliconplasmid pXF51 [GenBank: NC_002490] [Browse all T4SS(s) in this replicon]
Location [Strand]13194..15164 [+]
Productconjugal transfer protein
Component typeVirD4
UniProt IDQ9PHI9
KEGG IDxfa:XFa0016
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.1e-108, Aligned region: 88..540
TraG-D_C [PF12696], Evalue: 2.6e-26, Aligned region: 380..501
TrwB_AAD_bind [PF10412], Evalue: 2.6e-20, Aligned region: 298..515
Protein Sequence: 656 a.a.     [Download]
>gi|10956727|ref|NP_061672.1| conjugal transfer protein [Xylella fastidiosa 9a5c]
MVIIALVAVVTGVWAYLAGGIFLMAFGHKFEESTPLTLYQYWFYYGAEKQAKKWLYISSGISLAVLLAPL
LFFFSHAEKSLFGDARFAKLREIKNAGLMGKRGIILGLYMNTYLLFGGSQHVSISAPTRSGKGVGIVIPN
LLSWPDSVVCSDIKIENFAITSAYRQKHGQECYLFNPVSTEYKTHRYNPLSYISEDPHFRIDDIQKIGNM
LFPDVPGTDVIWTATPRSLFLGIVLMLLETQGKLVTFGQVLRETLQDGDGSVYFGKIINERAKAGNPYSG
PCIRALNSYISIASENTRSGVMTSFRSKLELWMNPIIDAATSGNDFDLRDLRKKRMSVFVGVTPDNLKRL
APLLNLFYQQLIDLNTRELPEHNPALKYQCLLMMDEFTALGKLDCLADGISFIAGYGLRLLPIFQSPAQI
VGKYGEAAAETFSTNHAAQIIYPPKVTEIKTAREISEWLGFQTVKGVSESKGKGIFTKKSESQSISDQRR
ALLLPQEITSLGSKRALVVVEDCPPILAKRIRYFREHVFMDRLKSVSPSLAKFGNKLPNEKQLKAIIESG
ELAVKVPVIDIDEHICMVSGSTVAQTTVVVQSNGKTEVHVFERLITPADMPNLAKIALANLNIDFSAVEK
AKDGQLDEAALHSYVENLSKQSLDNV
 
Nucleotide Sequence: 1971 bp     [Download]
>gi|10956711|ref|NC_002490.1|:13194-15164 Xylella fastidiosa 9a5c plasmid pXF51, complete sequence
GTGGTTATTATCGCGCTGGTTGCCGTGGTAACGGGTGTTTGGGCTTACCTGGCCGGTGGCATCTTTCTTA
TGGCTTTCGGCCATAAGTTTGAAGAATCCACGCCTTTGACCTTGTATCAGTATTGGTTTTATTACGGGGC
CGAAAAGCAAGCAAAAAAATGGCTCTATATTTCAAGCGGCATTTCGCTGGCCGTGCTGCTGGCTCCACTG
CTTTTCTTTTTCTCGCATGCGGAAAAAAGCCTGTTCGGTGACGCTCGCTTTGCCAAGCTACGCGAGATTA
AAAACGCTGGCTTGATGGGTAAAAGAGGCATCATCCTTGGCCTCTACATGAATACTTACTTACTGTTCGG
CGGTAGCCAGCACGTCAGTATTTCAGCGCCTACTCGCTCGGGTAAGGGCGTTGGTATTGTGATTCCGAAC
CTGCTTTCTTGGCCAGATAGCGTGGTTTGCAGCGACATCAAGATTGAAAACTTCGCCATCACAAGCGCCT
ACCGCCAAAAGCACGGCCAAGAATGCTATCTGTTCAATCCGGTTTCTACCGAATACAAGACGCATCGGTA
TAACCCGCTTTCCTATATCAGCGAAGACCCGCATTTTCGCATTGATGACATTCAAAAAATCGGGAACATG
CTGTTTCCTGATGTGCCTGGCACTGACGTAATTTGGACAGCCACGCCACGAAGCCTGTTCTTGGGCATCG
TCTTGATGCTATTGGAAACGCAGGGCAAGCTAGTCACGTTCGGCCAAGTCTTACGCGAAACGCTGCAAGA
CGGCGATGGCTCTGTCTACTTCGGCAAGATCATCAACGAAAGGGCCAAAGCGGGCAATCCATACTCTGGC
CCATGCATCCGTGCACTGAATAGCTATATCTCGATTGCCTCGGAAAACACACGCTCCGGTGTGATGACCT
CTTTCCGGTCGAAGCTGGAACTGTGGATGAACCCGATTATTGACGCGGCCACAAGCGGCAATGACTTTGA
CCTACGCGACTTGCGTAAAAAACGCATGTCGGTGTTTGTCGGTGTGACGCCAGATAACTTGAAGCGTCTA
GCTCCGTTGTTGAACTTGTTTTATCAACAGTTGATTGACCTAAATACGCGGGAATTACCCGAACACAACC
CTGCATTGAAATATCAATGCCTGTTGATGATGGACGAATTTACCGCCCTCGGGAAACTCGATTGTCTGGC
CGATGGCATCAGCTTTATTGCCGGTTATGGCCTGCGACTTCTGCCAATCTTCCAAAGCCCTGCGCAGATC
GTCGGTAAGTATGGCGAAGCTGCGGCGGAAACCTTCTCTACGAATCACGCGGCGCAAATCATCTATCCAC
CCAAGGTGACGGAAATTAAGACTGCCCGCGAGATTTCAGAATGGCTCGGCTTCCAGACTGTCAAGGGTGT
TTCCGAGTCCAAGGGGAAGGGCATCTTCACCAAAAAATCAGAATCGCAAAGCATATCTGACCAGCGCCGT
GCGCTGCTCCTACCGCAAGAAATTACAAGCCTTGGCTCTAAACGCGCCCTGGTGGTGGTTGAAGACTGCC
CACCGATTCTGGCGAAGCGGATTCGCTATTTCCGCGAGCATGTCTTTATGGACAGGCTCAAGAGCGTTTC
GCCTAGCTTGGCGAAATTCGGTAACAAGCTGCCGAATGAAAAGCAGTTGAAGGCAATCATTGAGTCCGGC
GAACTGGCCGTTAAGGTGCCGGTGATTGATATTGACGAGCATATCTGCATGGTTTCTGGTTCTACTGTCG
CCCAGACAACGGTAGTTGTACAGTCGAATGGAAAAACTGAAGTTCATGTTTTTGAACGCCTGATTACTCC
TGCCGACATGCCGAATCTAGCCAAGATCGCCTTGGCTAATTTAAACATCGATTTTTCGGCGGTCGAAAAA
GCAAAGGATGGCCAACTGGATGAAGCAGCGCTTCATTCCTACGTCGAAAACCTTTCCAAACAATCTTTAG
ACAACGTGTGA
 Primer design