SecReT4
Protein ID: 10956918
T4SS name [ID]Tra_F [526]
Gene symboltraD
Locus tagpNL1_p090
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]90847..93177 [+]
ProductConjugal DNA metabolism
Component typeTraD_F
UniProt IDO85919
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.3e-141, Aligned region: 226..610
T4SS-DNA_transf [PF02534], Evalue: 3.6e-21, Aligned region: 237..396
T4SS-DNA_transf [PF02534], Evalue: 3.6e-21, Aligned region: 431..595
TraG-D_C [PF12696], Evalue: 2.9e-19, Aligned region: 470..591
AAA_10 [PF12846], Evalue: 5.5e-13, Aligned region: 240..282
AAA_10 [PF12846], Evalue: 5.5e-13, Aligned region: 443..546
Protein Sequence: 776 a.a.     [Download]
>gi|10956918|ref|NP_049138.1| Conjugal DNA metabolism [Novosphingobium aromaticivorans]
MRRPDTWSDQARPGQLKHHSARGNMPRNAGNFTRGSQLITHEFLMWFSSAKMPLLVWFFTFLIALSIVLA
LLLHEHEVQMILMRIYAEGWSFMEFSPRKILNLTLPSGRVIPAPVSMIASHPDVVIAWNKLMRAIWGSLF
ISLFVAVPLSVWFIDLSRKRGKAILEERHQRGAMLVDAKELAAVINQHNSAALAQEIAERMPGKTMDDVM
KMSFAERKAAGIHHVYNIAGVSFPWRSEQAHTIMIGSTGTGKTTQMRDMIAQMRVRQDRAVVFDLTGAYV
EAFYNPETDTILNPMDERCPSWSLFDEGKNYADFTAIASAILPTDGGGSDPFWMLGARTLFVQTCVQLMK
LGQATNAALAYRLMMADLEEVHELLRNTIAEPLTAPVAARMAESVRAVLNTNAQALLFIPEGKEPFSICD
WIRHQDKPGSILFITSSHNELVLNRALLSLWMNLAVHTLMRLPRTRSLRTWFFFDEVHALHRLPAIEDGL
QTARGFGGAFVLGIHSFAKLAETYGKEGAQNLASLARTKLILAAADRDTAEHCSDYIGHREVRMMDEAYS
YGYSNIRDAATITPRSEVQPLVIPDDIMRLPSLRGFLVFPEGFDAARIRLTYKDYPKVAEGYILRENVEP
IEFISMPKGDDEVAETGGRDRSGEPELEPRGEDLGRDPAVPLSPALEPDANAPEIMPDGPNPDPSVGKQM
AFRLEQAPQNERTNSREQDPSQKAEKSSASKPAAQRTVGSRELNDPAIPDKESERGAKTAKGIEDQSHSR
DDGPEL
 
Nucleotide Sequence: 2331 bp     [Download]
>gi|10956828|ref|NC_002033.1|:90847-93177 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGCGTCGTCCTGACACCTGGTCCGATCAGGCCCGCCCCGGCCAGCTCAAGCACCATTCGGCGCGCGGGA
ACATGCCGCGCAACGCGGGCAATTTCACTCGCGGCTCGCAGCTCATCACGCACGAATTCCTGATGTGGTT
TTCCTCGGCGAAGATGCCGCTGCTGGTGTGGTTCTTCACGTTCCTGATCGCGCTCTCGATCGTCCTCGCG
CTGCTGCTTCACGAGCATGAAGTGCAGATGATCCTGATGCGGATCTATGCGGAGGGATGGAGCTTCATGG
AGTTCAGCCCGCGCAAGATCCTCAACCTAACCTTGCCCTCCGGCCGCGTGATCCCTGCCCCCGTTTCGAT
GATCGCCAGCCACCCTGATGTCGTCATCGCCTGGAACAAGCTGATGCGCGCAATTTGGGGTTCGCTGTTC
ATCTCGCTGTTCGTCGCGGTGCCGCTTTCGGTCTGGTTCATCGACCTCTCGCGCAAGCGCGGCAAGGCGA
TCCTCGAAGAACGCCACCAGCGCGGCGCGATGCTGGTCGACGCCAAGGAGCTTGCCGCCGTGATCAACCA
GCACAACAGCGCCGCGCTTGCCCAGGAGATTGCCGAACGGATGCCCGGCAAGACCATGGACGACGTCATG
AAAATGAGCTTTGCCGAGCGCAAGGCCGCCGGCATCCACCACGTCTACAACATCGCCGGCGTATCGTTTC
CGTGGCGGAGCGAACAGGCTCACACGATCATGATCGGGTCGACCGGGACCGGCAAGACCACGCAGATGCG
GGACATGATCGCGCAGATGCGCGTGCGCCAGGATCGGGCGGTCGTGTTCGATCTTACCGGGGCCTACGTC
GAGGCGTTCTATAACCCCGAGACCGACACGATCCTCAACCCGATGGACGAGCGCTGCCCGAGCTGGTCGC
TGTTCGACGAGGGCAAGAACTACGCCGACTTCACCGCGATCGCATCAGCCATCTTGCCGACCGACGGCGG
CGGCTCGGACCCCTTCTGGATGCTGGGAGCAAGGACATTGTTTGTGCAGACCTGCGTCCAGCTCATGAAG
CTCGGCCAGGCGACCAACGCCGCACTCGCCTACCGGCTGATGATGGCCGACCTTGAAGAGGTCCACGAAC
TGCTTCGCAATACCATTGCCGAGCCGCTGACCGCGCCAGTCGCGGCGCGCATGGCCGAGTCTGTCCGTGC
AGTTCTCAACACCAATGCCCAGGCCTTGTTGTTTATTCCCGAAGGCAAGGAACCCTTCTCGATTTGCGAC
TGGATTCGCCACCAGGACAAGCCGGGCTCGATCCTGTTCATTACCTCTTCGCATAACGAACTGGTGCTCA
ACCGGGCGCTCTTGTCGCTGTGGATGAACCTTGCGGTGCATACCCTGATGCGGCTGCCGCGCACCCGGTC
ATTGCGCACCTGGTTCTTCTTCGACGAAGTCCATGCGCTGCACCGCCTGCCAGCGATCGAAGACGGCTTG
CAGACTGCGCGCGGCTTTGGCGGCGCCTTCGTGCTCGGCATCCATTCCTTCGCCAAGCTAGCCGAGACCT
ATGGCAAGGAAGGCGCGCAGAACCTTGCCTCGCTGGCCCGCACCAAGCTGATCCTGGCAGCGGCCGATCG
CGACACCGCCGAGCACTGCTCGGACTACATTGGTCACCGCGAAGTGCGGATGATGGATGAGGCCTACAGC
TACGGCTATTCCAACATCCGCGACGCCGCGACCATTACCCCGCGCTCGGAAGTGCAGCCGCTGGTGATCC
CCGATGACATCATGCGCCTGCCTTCGCTGCGCGGGTTCCTGGTCTTTCCGGAAGGGTTCGATGCGGCGCG
GATCAGGCTCACCTACAAGGACTACCCCAAGGTCGCAGAGGGCTACATTCTGCGCGAGAACGTCGAGCCT
ATCGAGTTCATCTCCATGCCCAAGGGTGACGATGAAGTCGCCGAGACCGGCGGCCGGGACCGCAGCGGCG
AACCGGAACTGGAGCCGCGCGGCGAAGACCTTGGGCGCGACCCCGCAGTGCCGTTGTCACCGGCGCTCGA
GCCCGACGCCAATGCGCCGGAAATCATGCCCGATGGACCAAATCCTGATCCCAGTGTCGGCAAGCAGATG
GCATTTCGTCTGGAGCAAGCGCCTCAGAACGAACGCACCAATAGCCGCGAGCAGGACCCGAGTCAGAAGG
CTGAAAAGAGTTCCGCGTCCAAGCCTGCCGCGCAGCGCACCGTCGGGTCCCGCGAACTCAATGACCCCGC
CATCCCCGACAAGGAATCTGAGCGCGGCGCGAAGACCGCCAAGGGGATCGAGGACCAATCGCATTCCCGT
GACGACGGACCGGAGCTCTAG
 Primer design