SecReT4
Protein ID: 10956919
T4SS name [ID]Tra_F [526]
Gene symbolorf704
Locus tagpNL1_p091
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]93181..96222 [+]
ProductDNA helicase
Component typeTraI_F
UniProt IDO85920
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 8.4e-86, Aligned region: 7..285
AAA_30 [PF13604], Evalue: 3.7e-47, Aligned region: 469..682
Protein Sequence: 1013 a.a.     [Download]
>gi|10956919|ref|NP_049139.1| DNA helicase [Novosphingobium aromaticivorans]
MHSIASVRSSSGAADYFANDNYYSADEHAEAGVWGGEGARALGLEGQVERDAFEGVLNGRLPDGEMVGQV
EGRRLGLDLTFSMPKSASILALVSGDRRIIDAHLAAVKSTMSQLVEKQFAESRNYERSRSGEPQKTGNLV
YALFAHDTSRALDPQGHIHAVVANLTRDPKGTWKALWNGEIWKNNTTIGQFYHAAFRAQLQKLGYETEAA
GKHGSFEIKGVPAEVIKAFSTRTTEIEAKIAEVGATRLETKKQITLYTRDPKLAVEDRGALVEGWQQRAA
ELGFDGKALVAAAKARAEVEARPSFRETATAAIGEVSTRINAALRTPSPLAVSGAAALFLSAATIKAQHA
TASAIRHLSEREAAFSPQAILASALGFHIKGLEGGAVVQRIGELIRDGHLIPGKSDRLDGHSDLVTTPAA
LAMEQRILDTIERGHGEGRAFMPPEAAMTRLQEAARELGRERAGVDTWQLNEGQLAAGVAILSGGDRFLN
VQGVAGAGKSTLLGALDKVLDAEGVKLVGLAFQNKMVADLRGGGGQGMSADQMREAGIEAYTIARFLNTY
SSAAAAGSGERYEAAKAALANTVIITDESSMVSSRDMLRLVTLAEQLDLAKAPFMGDRQQLSAIEQGKMF
AVSQASGQATVRMDENIRQKNSPLLLAVAGLSNEGHAGLALDLLAAHGRVIEAGPDHVARAAELWLSLEP
DKREATAIFTAGRDDRAEINARVQAGLLKEGTLSGAGVPLATLQSVNATREELRFASTYRVGQVLEARME
VREIGLKAGEYRVSEVRKDGKVVLERDGKRKVIDPDRINPDHRFDRLGLHEEKQIRLHDGETVFWRDKDG
SRDIAKSTYATVLEARAEGIRVELADKRQLVLVPGDPMLRRLDLGYALNAHMAQGMTKPQAIEVISSTQR
NLATQRTQNVLNTRATDDMTVVTNNLEGLKQQLDRTPGNKTSALEVTGKVEVEPRHVNPIDTRQVPELRM
SPELKAKLDAVLGKVAEAPVKQMRPEKTLGLDL
 
Nucleotide Sequence: 3042 bp     [Download]
>gi|10956828|ref|NC_002033.1|:93181-96222 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGCACTCGATCGCCTCCGTCCGGTCGTCGAGCGGCGCTGCCGACTACTTCGCCAACGACAACTACTACT
CGGCCGATGAGCACGCGGAAGCGGGGGTCTGGGGCGGCGAAGGTGCGCGCGCGCTGGGGCTTGAGGGGCA
GGTCGAGCGCGATGCGTTCGAGGGCGTGCTCAATGGGCGGCTGCCCGACGGCGAGATGGTCGGGCAGGTC
GAAGGTCGGCGCCTGGGTCTCGATCTCACCTTCTCGATGCCCAAGTCTGCCTCGATCCTGGCGCTGGTCA
GCGGCGACCGGCGGATCATCGATGCGCACCTGGCGGCGGTCAAATCGACCATGTCGCAGCTTGTCGAAAA
GCAGTTCGCCGAGAGCCGCAACTATGAGCGCAGCCGCAGCGGCGAACCCCAGAAGACCGGTAACCTCGTC
TATGCCCTGTTCGCCCACGATACGAGCCGCGCGCTCGATCCGCAGGGGCATATCCACGCCGTCGTCGCCA
ATCTGACTCGCGATCCCAAGGGCACCTGGAAGGCGCTGTGGAACGGCGAGATCTGGAAGAACAACACCAC
GATCGGCCAGTTCTACCACGCCGCCTTCCGCGCCCAGTTGCAGAAGCTCGGCTACGAAACCGAGGCTGCC
GGCAAACACGGGTCGTTCGAGATCAAGGGCGTGCCCGCCGAGGTGATCAAGGCCTTCTCGACCCGCACCA
CCGAGATCGAGGCGAAGATCGCCGAGGTCGGGGCAACCCGCCTCGAAACCAAGAAGCAGATCACGCTTTA
TACCCGCGATCCCAAGCTGGCGGTCGAGGATCGCGGCGCACTGGTCGAGGGCTGGCAGCAGCGCGCGGCC
GAGCTCGGGTTCGACGGCAAGGCTCTTGTTGCCGCAGCCAAGGCGCGCGCCGAAGTCGAGGCGCGGCCGA
GCTTCCGCGAGACGGCCACGGCCGCGATCGGCGAAGTTTCGACCCGGATCAACGCCGCGCTGCGCACCCC
AAGTCCGCTTGCCGTGAGCGGGGCCGCAGCATTGTTCCTGTCGGCCGCCACCATCAAGGCTCAGCACGCC
ACCGCTTCGGCGATCCGTCATCTCTCCGAGCGCGAGGCAGCGTTCTCGCCGCAGGCAATCCTGGCGAGCG
CGCTGGGGTTCCATATCAAGGGCCTCGAGGGCGGCGCAGTGGTCCAGCGAATTGGCGAGCTCATTCGCGA
CGGGCACCTGATCCCCGGCAAGTCGGACCGGCTCGACGGGCACTCCGATCTCGTGACCACGCCGGCCGCA
CTGGCCATGGAGCAACGCATCCTTGACACCATCGAGCGGGGTCATGGCGAGGGCCGCGCCTTCATGCCGC
CCGAGGCGGCGATGACCCGGCTGCAGGAGGCCGCGCGTGAACTTGGGCGCGAGCGTGCCGGGGTGGACAC
CTGGCAACTCAACGAAGGCCAACTCGCGGCGGGCGTGGCGATCCTCTCAGGCGGCGATCGCTTCCTCAAC
GTCCAGGGCGTCGCCGGTGCGGGCAAATCCACCCTGCTAGGCGCACTCGACAAGGTGCTGGACGCGGAAG
GCGTGAAGCTTGTCGGGCTCGCTTTCCAGAACAAGATGGTCGCTGATCTGCGCGGTGGCGGCGGTCAGGG
CATGTCGGCCGACCAGATGCGCGAGGCGGGGATCGAAGCCTATACCATCGCCCGGTTCCTCAATACCTAC
AGCTCGGCGGCCGCTGCAGGCAGCGGCGAGCGCTACGAGGCAGCGAAGGCTGCGCTCGCCAATACCGTCA
TCATCACCGACGAAAGCTCGATGGTTTCCTCGCGCGACATGCTGCGCCTGGTGACGCTCGCCGAGCAGCT
CGACCTCGCCAAGGCGCCGTTCATGGGCGACCGCCAGCAATTGTCGGCGATCGAGCAGGGCAAGATGTTC
GCGGTCTCGCAGGCCTCTGGTCAGGCGACCGTGCGGATGGATGAGAACATACGCCAGAAGAACTCGCCGC
TTCTCCTCGCAGTTGCGGGGCTCTCGAACGAGGGCCATGCCGGCCTCGCACTTGACCTGCTTGCCGCGCA
CGGCCGCGTAATCGAAGCAGGGCCCGACCATGTCGCCCGCGCCGCCGAGCTGTGGCTCTCGCTCGAACCC
GACAAGCGCGAAGCGACCGCGATCTTCACCGCCGGGCGTGACGATCGCGCCGAGATCAACGCTCGGGTCC
AGGCGGGGTTGCTCAAGGAAGGGACATTGAGCGGCGCGGGCGTGCCGCTGGCGACCCTCCAGAGCGTCAA
CGCCACCCGCGAGGAGCTGCGGTTCGCCTCGACCTACCGGGTGGGTCAGGTGCTTGAGGCGCGGATGGAG
GTGCGCGAGATCGGCCTCAAGGCCGGCGAATACCGGGTGAGCGAGGTGCGCAAGGACGGCAAGGTCGTGC
TCGAGCGCGATGGCAAGCGCAAGGTCATCGATCCTGACCGGATCAATCCCGATCACCGCTTCGACCGGCT
CGGGCTTCATGAAGAGAAGCAGATCCGCCTCCACGACGGCGAAACCGTGTTTTGGCGTGACAAGGACGGG
TCCCGAGACATTGCCAAGTCGACCTACGCCACCGTGCTCGAGGCGCGAGCAGAAGGCATCCGGGTCGAAC
TTGCGGACAAGCGGCAGCTTGTCCTGGTCCCCGGCGATCCGATGCTGCGCCGTCTCGACCTTGGCTATGC
GCTCAACGCTCACATGGCGCAGGGCATGACCAAGCCACAGGCGATCGAGGTCATCTCTTCGACCCAGCGC
AACCTTGCCACCCAGCGCACGCAGAACGTCCTCAATACCCGCGCCACTGACGACATGACCGTCGTCACCA
ACAACCTCGAAGGCCTGAAACAGCAACTCGACCGCACGCCCGGCAACAAGACCTCAGCGCTCGAAGTCAC
CGGTAAGGTCGAGGTTGAGCCGCGCCATGTGAACCCGATCGATACCCGGCAGGTGCCCGAACTCCGCATG
AGCCCCGAGCTCAAGGCCAAGCTCGACGCAGTGCTCGGCAAGGTGGCGGAGGCGCCGGTGAAGCAGATGC
GCCCGGAAAAGACGCTGGGGCTCGACCTGTGA
 Primer design