SecReT4
Protein ID: 10956931
T4SS name [ID]Tra_F [526]
Gene symboltraG
Locus tagpNL1_p103
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]103653..106391 [-]
Productsex pilus assembly and mating pair stabilization protein
Component typeTraG_F
UniProt IDO85931
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 6e-116, Aligned region: 3..458
Protein Sequence: 912 a.a.     [Download]
>gi|10956931|ref|NP_049151.1| sex pilus assembly and mating pair stabilization protein [Novosphingobium aromaticivorans]
MLEVFTVGGGDYLVNTFNAIAAWTGSGGFKSLIRVVMVMGLIYALLITAMDLDWRAWFRWFIQSTLIYTV
LMVPTVTVKVTDRVNPGLAPATVANVPIGLAAMASFTSQISDYLTRTAETVFVMPAALNYSTGGFVYGAR
MWDKARGFEIRDPVFKANLDGYLKQCAYYDILLGTKSLKLLSEAPDLWAELGVNAATNRGMKYLTDTGTG
TVDIEGKTCAQAWTLINNQWDNQINAYALPFAHTMYPKLTEAAAGAKLAADVPAVSQLLTGTAMTRNQFF
KQKSMVDAFEAAQLDFGNADADSFALQRADTQTRNAMTTAAEQGLIWIPVLGVVLTVVFYALFPIVFPLL
LFPRTGIATLKGYFSGFFYLSAWGPIYVLIHSFIMDRLASQTAAVSAGSVNLANWAGIDAVNQDIATMAG
FLMLSVPMLALMVMRGTMSVANNLGSMLAPVQAGSDAAAIERTTGNYAYGDVSYGNLNADNRQMSQWNQA
PNLLAGAGHSGFREADGRMFNEYGSGHSVIDTNAAMSQLPFKPTMTRGYATDLRSQGQWYLNEADKIENG
TSSSWTSSKGQFGSAVTATSDVTGARRESGSRASDTHNVGGNVVVEQAKGSSTRDVTNNDLILREGNSRS
SGDFASRTFGSSASLTGSGTLGTPGKDIAGSGASATLQGSIFGRKEVGDDARAGTERSATNQTTRGTDKS
DETSDRMVVSGSSGDIQSSGTYSQSSDYTDHSRSHTTTDGSDWRVAEAEERRAAAARYREIGSRMMSEAS
YAESHGFQISSDMSNLIQDRYEALQREHPEWHLPDLSNPRLDYRDVTRRDQAITYIMDDLMGDLRAHRID
ELSDIAGIAGNGSLGTNTDLGMPQTPSLPSPRAEGLVPSPLEGGTLLAVPNGPVDGAALERFSISLDHIR
MN
 
Nucleotide Sequence: 2739 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c106391-103653 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGCTCGAGGTCTTCACGGTCGGGGGCGGCGACTACCTCGTCAACACCTTCAACGCGATCGCCGCCTGGA
CCGGCTCGGGCGGGTTCAAGTCGCTGATCCGCGTCGTCATGGTGATGGGGCTGATCTACGCGCTCCTCAT
TACCGCGATGGACCTCGACTGGCGCGCGTGGTTTCGCTGGTTCATCCAGTCGACGCTGATCTACACCGTG
TTGATGGTCCCGACGGTGACGGTGAAGGTCACCGACCGTGTCAATCCCGGGCTTGCGCCCGCCACGGTCG
CCAACGTGCCGATCGGGCTCGCAGCCATGGCCTCGTTCACCAGCCAGATCAGCGACTACCTGACCCGCAC
GGCCGAGACAGTCTTCGTCATGCCTGCTGCGCTCAATTACTCGACCGGCGGCTTCGTTTACGGCGCGCGG
ATGTGGGACAAGGCGCGCGGGTTCGAGATCCGTGATCCCGTGTTCAAGGCCAACCTCGACGGCTACCTCA
AGCAGTGCGCCTATTACGACATCCTGCTTGGCACCAAGAGCCTCAAGCTGCTGAGCGAAGCGCCCGACCT
CTGGGCCGAACTCGGGGTCAATGCCGCAACCAACCGCGGCATGAAGTACCTGACCGATACCGGCACCGGC
ACGGTCGATATCGAGGGCAAGACCTGTGCGCAGGCCTGGACGCTGATCAACAACCAGTGGGACAACCAGA
TCAACGCCTATGCGCTGCCATTTGCGCATACGATGTACCCCAAGCTCACCGAGGCCGCGGCAGGGGCAAA
GCTCGCCGCCGACGTGCCGGCGGTCTCGCAATTGCTCACCGGCACCGCGATGACGCGTAACCAGTTCTTC
AAGCAGAAGAGCATGGTCGACGCTTTCGAGGCCGCCCAGCTCGACTTCGGCAATGCCGATGCCGATTCCT
TCGCGCTCCAGCGCGCGGACACCCAGACCCGCAACGCGATGACGACGGCAGCCGAGCAGGGGCTCATCTG
GATTCCGGTGCTTGGCGTGGTCCTGACCGTGGTCTTTTACGCTCTGTTCCCGATCGTCTTCCCGCTGCTG
TTGTTCCCGCGCACCGGCATCGCGACCCTGAAGGGCTACTTCTCGGGCTTCTTCTACCTCTCGGCCTGGG
GACCGATCTACGTTCTCATCCACTCGTTCATCATGGACCGCCTGGCCTCCCAGACCGCAGCGGTTTCAGC
AGGCAGCGTGAACCTCGCCAACTGGGCGGGAATCGATGCGGTTAATCAGGACATCGCCACGATGGCGGGG
TTCCTGATGCTCTCCGTGCCGATGCTCGCGCTGATGGTCATGCGCGGCACCATGTCGGTCGCCAACAACC
TTGGCTCGATGCTCGCCCCGGTCCAGGCTGGCTCGGATGCCGCGGCGATCGAGCGGACCACCGGCAACTA
TGCCTATGGCGATGTCAGCTATGGCAATCTCAACGCGGACAATCGGCAGATGTCGCAGTGGAATCAGGCC
CCCAACCTCCTGGCAGGCGCGGGCCACTCGGGCTTCCGCGAAGCGGACGGGCGCATGTTCAACGAATATG
GCTCGGGCCATTCGGTGATCGACACCAATGCGGCGATGTCCCAGTTGCCCTTCAAGCCCACCATGACGCG
GGGCTATGCGACGGACCTCAGATCCCAGGGCCAATGGTATCTCAACGAGGCCGACAAGATCGAGAACGGC
ACCTCGAGCAGCTGGACCAGCTCGAAGGGCCAGTTCGGCAGCGCGGTCACCGCGACCAGCGACGTGACAG
GAGCCCGGCGCGAAAGCGGATCGCGCGCATCGGACACTCACAATGTCGGCGGCAACGTCGTCGTCGAACA
GGCCAAGGGCAGCTCGACCCGTGATGTCACGAACAATGATCTTATCCTGCGCGAGGGCAATTCACGTTCG
TCCGGTGATTTTGCGAGCCGCACTTTTGGCTCGTCCGCGAGCCTTACTGGATCTGGAACGCTGGGAACGC
CTGGCAAAGACATTGCGGGAAGTGGCGCCTCAGCAACGCTGCAGGGCTCCATTTTCGGTCGGAAAGAGGT
GGGCGACGATGCTCGTGCCGGCACCGAGCGTTCAGCAACGAACCAGACCACGCGCGGCACCGACAAATCC
GACGAGACGAGCGATCGCATGGTGGTCAGCGGGTCGAGCGGCGATATCCAGTCTTCGGGCACCTACAGCC
AGAGCTCGGACTACACTGACCATAGCCGCTCGCACACCACCACCGATGGAAGTGATTGGCGTGTCGCTGA
GGCCGAGGAACGGCGCGCCGCTGCTGCTCGCTATCGCGAGATAGGCAGCCGAATGATGTCCGAAGCGAGC
TACGCCGAAAGCCACGGCTTCCAGATTTCGAGCGATATGTCGAACCTGATCCAGGACCGCTATGAGGCCC
TGCAGCGCGAACACCCCGAGTGGCACTTGCCCGATCTTTCCAATCCGCGGCTCGACTATCGGGATGTGAC
GCGGCGCGACCAGGCCATCACATATATCATGGACGACCTGATGGGCGACTTGCGCGCTCACCGGATCGAC
GAGCTCAGCGACATCGCCGGGATCGCAGGCAATGGATCGCTGGGGACCAATACCGATCTCGGCATGCCGC
AAACCCCTTCGCTTCCATCCCCCCGCGCAGAGGGGCTGGTGCCTTCGCCGCTCGAAGGCGGCACACTGCT
TGCGGTGCCCAATGGTCCGGTCGATGGCGCCGCGCTAGAGCGATTTTCGATCAGTCTGGATCATATCCGC
ATGAACTGA
 Primer design