SecReT4
Protein ID: 10956932
T4SS name [ID]Tra_F [526]
Gene symboltraH
Locus tagpNL1_p104
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]106404..107858 [-]
Productpilus assembly and synthesis protein
Component typeTraH_F
UniProt IDO85932
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 4.9e-119, Aligned region: 42..398
Protein Sequence: 484 a.a.     [Download]
>gi|10956932|ref|NP_049152.1| pilus assembly and synthesis protein [Novosphingobium aromaticivorans]
MRARRFARRLHGASRRALGTVLGAAVLLASPTPASAGVEGEMQSFMSDMGVQANVTGPSAYQGQSAGYYS
MGSVWSRFPQKNIQPFNLQLPHARAGCGGIDLFAGSFSFINTAELVAMLKATANNALGFAFKLAIDTISP
EIGKVMDELAQKVQQMNQMNISSCETAQALVGGLWPKSDTASSVICEAIANSQGAVSDWARARQQCNNGG
QREALKSANSDPDMKEQAGMPNNYTWAALGKKYGGFDTQFREFLMTLVGTVIYDPAGNGGKPRVQFIGPA
DPALISAMLDGTSSTPHKYWSCGGDSAKCMAPSEIDMVIGPNAAIKARVRTLIESMALKVRDPGASLTPA
EIQLLGMASVPVYKIITVSAAAEFGISAQEINDLSEIVAVDLVTTMTMRFIDMAVNARSDFNGADADSLR
EWREGLYETRRNFLGIAARTSQRFDQTFALIQRTQMLEKTLRTQLSPQMSAALRFSRTLGSQVQ
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c107858-106404 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGCGCGCCCGTCGCTTCGCCCGCCGCCTCCATGGAGCCTCGCGCCGCGCACTTGGCACAGTCCTCGGTG
CCGCGGTTCTGCTCGCTTCGCCCACACCCGCCTCGGCCGGGGTCGAAGGCGAGATGCAGAGCTTCATGTC
CGACATGGGCGTCCAGGCCAATGTCACCGGTCCCAGCGCCTACCAGGGCCAGTCGGCGGGCTATTATTCG
ATGGGCTCGGTCTGGTCGCGCTTCCCGCAAAAGAACATCCAGCCCTTCAACCTCCAGTTGCCCCACGCGC
GCGCCGGGTGCGGCGGCATCGACCTCTTTGCCGGGTCGTTCTCGTTCATCAACACCGCCGAACTTGTCGC
CATGCTGAAAGCGACCGCGAACAACGCGCTCGGCTTTGCCTTCAAACTCGCGATCGACACGATCTCGCCC
GAGATCGGCAAGGTCATGGATGAGCTGGCGCAGAAGGTTCAGCAGATGAACCAGATGAACATCTCGTCCT
GCGAGACCGCGCAGGCGCTGGTCGGCGGCCTCTGGCCGAAGAGCGATACGGCGAGTTCGGTCATCTGCGA
GGCGATCGCCAACAGTCAGGGCGCGGTCTCCGACTGGGCCCGCGCGCGCCAGCAGTGCAACAACGGCGGC
CAGCGCGAAGCCTTGAAAAGCGCCAATTCCGACCCGGACATGAAGGAACAGGCCGGGATGCCCAACAATT
ACACCTGGGCGGCATTGGGCAAGAAATACGGTGGGTTCGACACCCAGTTCCGCGAGTTCCTGATGACCCT
CGTCGGGACCGTGATCTACGATCCGGCCGGTAATGGCGGCAAGCCGAGGGTCCAGTTCATCGGCCCGGCC
GACCCGGCGCTGATCAGCGCCATGCTCGACGGCACCTCTTCCACCCCGCACAAATACTGGAGCTGCGGCG
GCGATAGCGCCAAGTGCATGGCGCCGAGCGAGATCGACATGGTGATCGGGCCTAATGCAGCGATCAAGGC
GCGGGTGCGCACGCTGATCGAGAGCATGGCCTTGAAAGTGCGCGATCCCGGCGCCTCGTTGACCCCGGCC
GAGATCCAGCTCCTCGGCATGGCGAGCGTGCCGGTCTACAAGATCATCACCGTGAGCGCAGCGGCCGAGT
TCGGCATCTCCGCGCAGGAGATCAACGACCTTTCCGAAATAGTCGCGGTCGATCTCGTCACCACCATGAC
CATGCGGTTCATCGACATGGCAGTGAACGCGCGTTCGGACTTCAACGGGGCTGATGCGGATAGCTTACGC
GAATGGCGCGAGGGGCTTTACGAGACCCGGCGCAATTTCCTCGGGATCGCGGCGCGCACCTCGCAGCGCT
TCGACCAGACCTTTGCGCTGATCCAGCGCACGCAGATGCTCGAAAAGACCCTGCGTACCCAGCTCTCGCC
CCAGATGTCGGCCGCGCTGCGCTTTTCGCGCACGCTCGGCAGCCAGGTCCAGTAA
 Primer design