SecReT4
Protein ID: 10956933
T4SS name [ID]Tra_F [526]
Gene symboltraF
Locus tagpNL1_p105
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]107858..108670 [-]
Productpilus assembly and synthesis protein
Component typeTraF_F
UniProt IDO85933
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.6e-69, Aligned region: 48..259
Protein Sequence: 270 a.a.     [Download]
>gi|10956933|ref|NP_049153.1| pilus assembly and synthesis protein [Novosphingobium aromaticivorans]
MNHRQCIALLAASSVALTGTAPLRASEGDGVEVRQSEDALYCKERKLGTWFYCEKPKEEPRKAAAAQPPA
RERLAAIGTQLEELKARAILEPSPENVTAYVRFQREQLDRSSMFADVWQRALWQDPGLDYTLQRPVSTLG
KRAWIDERKTDRDRVMANLSQRYGVFYFFASSCGACDIFSPILKAVSDKYGLAVLAVSTDGGPSSTFPGY
MVDSGQYEKLGLGTDRQVPALVLFDSVTKQPMPIGYGILSQDEIMDRVFQLTQVKVGSDY
 
Nucleotide Sequence: 813 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c108670-107858 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGAACCACCGCCAATGCATTGCCCTGCTTGCCGCCTCCAGCGTCGCGCTTACCGGGACCGCACCGCTGC
GCGCCTCCGAGGGCGACGGTGTCGAGGTGCGGCAGTCCGAGGACGCGCTCTACTGCAAGGAGAGGAAGCT
CGGCACCTGGTTCTACTGCGAGAAGCCCAAGGAGGAGCCGCGCAAAGCTGCTGCTGCGCAGCCACCAGCG
CGCGAGCGACTGGCCGCAATCGGGACCCAGCTTGAAGAACTGAAGGCGCGCGCGATCCTCGAGCCGAGCC
CGGAGAACGTCACCGCCTATGTCCGCTTCCAGCGCGAACAGCTCGACCGCTCCTCGATGTTCGCCGACGT
CTGGCAGCGCGCGCTGTGGCAGGATCCCGGGCTCGACTACACGCTGCAGCGCCCGGTCTCGACGCTCGGC
AAGCGCGCCTGGATCGACGAGCGCAAGACCGACCGCGACCGGGTCATGGCCAATCTCTCGCAGCGCTACG
GGGTGTTCTACTTCTTCGCCTCGAGCTGCGGCGCCTGCGACATCTTCTCGCCGATCCTCAAAGCCGTCTC
GGACAAGTACGGCCTCGCGGTGCTCGCGGTCTCCACCGATGGCGGACCTTCCTCGACCTTCCCCGGCTAC
ATGGTCGACAGCGGGCAATACGAGAAGCTCGGGCTTGGCACCGACCGCCAGGTGCCCGCGCTGGTGCTGT
TCGATTCAGTCACCAAGCAGCCGATGCCGATCGGCTACGGAATCCTCAGCCAGGACGAGATCATGGACCG
CGTCTTCCAGCTGACGCAGGTCAAGGTGGGGAGCGACTACTGA
 Primer design