SecReT4
Protein ID: 10956935
T4SS name [ID]Tra_F [526]
Gene symboltraN
Locus tagpNL1_p107
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]109058..111172 [-]
Productmating pair stabilization protein
Component typeTraN_F
UniProt IDO85935
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 2.8e-76, Aligned region: 408..654
Protein Sequence: 704 a.a.     [Download]
>gi|10956935|ref|NP_049155.1| mating pair stabilization protein [Novosphingobium aromaticivorans]
MRAPRLAGFALAGMVLLAAAGAQGQVYIPPPDDLVEPQPPLPPAIDPGVPAPAPPPPSAPATMTVDEAKA
EARATGSSVRGAYQGITDAPGAAGQIPGYQAEYPGLTQYYDNPGNMYADGAAAGVNSNAYRTANSTTRPT
VDVTRADLSRANTVTDDPNAYLSGMSADGSTGNCVPLPPSPGTTNTAEWTCNVGSSVVEQPKTCTRSLTV
APWNETLYQYLCVTAPGFPGCASLEGNALCRKTGTFPVPDYNLTVDYYDCDAGVSDPNVYLMGTVAKPPP
ADAFQVVSNVYRCNNEGITDALTFDPVTGFPVQYVSGLQQCGAISAEPSCTQTTASAAGLTDRQLCKTWD
FIGDPFGGGGYLTCLEPASLEAVYSCSTNVAGIVPESSVSKWFTQVWTDNACSVDLGTCTLAAETCTAPN
ETRLIDGVPVTRACWETAKTYQCQTVVGGGNDCGKLDATPGCMFDHETCLDDPPSGDGSCKVAERVYKCP
IPGSTSQPAQYICGDDVYCVNGDCEPIVREASDEFKDAVVALNALGQANSEFDESTLTLFKGTAESCAHK
VFGLANCCSGKGVPLLVPLLCSPAEVLLDQKDDAGLCHKIGTYCSSSFLGICLSKRDVYCCFLSKISRIL
QEQGRPQIGKTWGTPKKPVCDGFTIFEFQQLDLSVMDFSEIYAEFVDAAKLPDEAATLIEIQAKIEAYYA
AHKP
 
Nucleotide Sequence: 2115 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c111172-109058 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGCGCGCGCCGCGCCTTGCTGGATTTGCGCTTGCCGGGATGGTGCTGCTCGCCGCGGCCGGCGCACAAG
GACAGGTCTACATCCCCCCGCCGGACGATCTGGTCGAGCCGCAACCGCCGCTCCCGCCCGCGATTGATCC
CGGTGTGCCCGCTCCCGCCCCGCCGCCTCCTTCCGCGCCTGCCACCATGACCGTGGACGAGGCCAAGGCC
GAGGCTCGGGCGACCGGATCGAGCGTGCGCGGCGCCTACCAGGGGATCACCGATGCCCCGGGTGCGGCCG
GGCAGATACCGGGGTATCAGGCGGAATATCCCGGACTCACCCAGTATTACGACAATCCCGGCAACATGTA
CGCCGATGGGGCGGCGGCCGGCGTGAATAGCAATGCCTACCGCACCGCCAATTCGACCACGCGGCCGACC
GTCGATGTCACCCGCGCCGACCTGTCCCGCGCCAACACCGTGACCGACGATCCCAATGCCTACTTGTCTG
GCATGAGCGCGGACGGGTCGACCGGCAATTGCGTCCCGCTGCCGCCGAGTCCGGGGACCACCAACACTGC
CGAATGGACCTGCAATGTCGGCTCGAGCGTGGTCGAACAGCCCAAGACCTGCACCCGCAGTCTCACCGTC
GCGCCATGGAACGAGACGCTCTACCAGTACCTCTGCGTCACGGCCCCTGGCTTTCCGGGCTGCGCCTCGC
TTGAGGGCAACGCCCTGTGCCGCAAGACCGGGACCTTCCCTGTTCCCGACTATAACCTCACGGTCGACTA
CTACGACTGCGACGCAGGCGTCAGTGATCCCAACGTCTACCTCATGGGCACGGTGGCCAAACCGCCGCCG
GCGGACGCCTTCCAGGTCGTGAGCAACGTCTATCGCTGCAACAACGAAGGGATCACCGATGCGCTGACCT
TTGATCCCGTGACGGGTTTTCCCGTCCAATATGTGAGCGGGCTTCAGCAGTGCGGGGCGATATCGGCGGA
GCCGAGCTGTACCCAAACCACCGCCTCCGCGGCAGGCCTCACCGACCGCCAGCTCTGCAAGACCTGGGAT
TTCATCGGCGATCCGTTCGGGGGAGGGGGCTACCTCACTTGCCTTGAGCCCGCTTCGCTAGAAGCGGTCT
ATTCGTGCAGCACCAATGTCGCCGGCATCGTGCCCGAAAGCTCGGTATCGAAGTGGTTCACCCAAGTCTG
GACCGACAATGCCTGCTCGGTCGATCTTGGCACCTGCACCCTCGCTGCCGAGACCTGCACTGCCCCCAAT
GAAACCCGCCTGATCGATGGCGTGCCGGTCACGCGGGCCTGCTGGGAGACGGCGAAGACCTACCAGTGCC
AGACCGTGGTGGGCGGCGGCAACGACTGCGGCAAGCTCGATGCAACCCCCGGCTGCATGTTCGACCACGA
GACCTGTCTCGACGATCCGCCCAGCGGAGATGGTTCGTGCAAGGTCGCCGAGCGTGTCTACAAGTGCCCG
ATCCCGGGATCGACGAGCCAGCCTGCGCAGTACATCTGCGGGGACGACGTCTACTGCGTCAATGGCGACT
GCGAGCCGATCGTTCGCGAGGCCTCCGACGAGTTCAAGGACGCGGTCGTGGCGCTGAACGCGCTCGGACA
GGCCAATTCCGAGTTCGACGAAAGCACGCTGACGCTGTTCAAGGGCACCGCCGAGAGTTGTGCGCACAAG
GTCTTCGGTCTCGCCAACTGCTGCTCGGGGAAGGGCGTCCCGCTCCTCGTTCCGCTGCTGTGCAGCCCGG
CCGAGGTGCTGCTCGATCAGAAGGACGATGCAGGGCTCTGCCACAAGATTGGCACTTACTGCTCGTCGAG
CTTCCTTGGCATCTGTCTTTCCAAGCGCGATGTCTATTGCTGCTTCCTCTCGAAGATCAGTCGGATCCTC
CAGGAGCAGGGCCGGCCCCAGATCGGCAAGACATGGGGAACGCCGAAGAAGCCCGTCTGCGACGGCTTCA
CCATTTTCGAGTTCCAGCAGCTCGACCTCTCGGTGATGGATTTTTCCGAAATCTACGCGGAGTTCGTCGA
TGCGGCGAAGCTCCCCGACGAAGCCGCCACGCTCATCGAAATCCAGGCAAAGATCGAGGCCTATTATGCC
GCGCACAAGCCCTGA
 Primer design