SecReT4
Protein ID: 10956936
T4SS name [ID]Tra_F [526]
Gene symboltrbC
Locus tagpNL1_p108
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]111174..111938 [-]
Productsex pilus assembly and mating pair formation protein
Component typeTrbC_F
UniProt IDO85936
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 7.8e-29, Aligned region: 120..232
Protein Sequence: 254 a.a.     [Download]
>gi|10956936|ref|NP_049156.1| sex pilus assembly and mating pair formation protein [Novosphingobium aromaticivorans]
MTFARTLLKPHLAGIAGFLALTAVSAALAQTLDGIDLKAIKDRATEATADAQTLVDAVAGKGEAHRAEAE
TLREQGLASVASIDPASLPKGPDGAVDFDELLAGAAANTRAPMGEGPMFMVFASLSMPGASLTRLIADTT
KAGGVVVFRGFPGGSTKAFAEGLKRVVTDEGQEAHLAIDPRLFRAFKVEAAPTFVAAGREYELCDGLDCT
SATPDHDRLTGNVTVEFALESFAGGRGPGAGVARIALAQLNKGH
 
Nucleotide Sequence: 765 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c111938-111174 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGACCTTCGCGCGCACCTTGCTTAAACCCCACCTCGCAGGAATCGCTGGCTTCCTCGCGCTTACGGCTG
TCTCGGCAGCGCTCGCGCAAACGCTAGACGGCATCGACCTCAAGGCCATCAAGGACCGGGCAACCGAGGC
GACAGCCGATGCCCAGACCTTGGTCGATGCGGTTGCCGGCAAGGGCGAGGCGCACCGCGCCGAGGCCGAG
ACCTTGCGCGAACAAGGCCTCGCTTCCGTCGCTTCGATCGATCCCGCGAGCCTTCCCAAGGGCCCGGATG
GCGCGGTCGACTTCGACGAACTGCTCGCCGGCGCCGCGGCCAATACCCGCGCGCCGATGGGCGAGGGGCC
GATGTTCATGGTCTTTGCCAGCTTGTCGATGCCTGGGGCCTCGCTCACCCGGCTGATCGCCGACACGACC
AAGGCCGGCGGCGTGGTGGTGTTCCGCGGCTTTCCCGGAGGCAGCACAAAAGCCTTTGCCGAGGGCCTCA
AGCGCGTTGTGACCGACGAGGGCCAAGAAGCCCATCTCGCGATCGACCCGCGCCTGTTCCGCGCCTTCAA
GGTCGAGGCTGCGCCGACCTTCGTCGCCGCGGGCCGCGAGTACGAGCTCTGCGACGGGCTCGACTGCACC
AGCGCCACTCCCGACCACGACCGGCTCACCGGCAATGTCACAGTCGAGTTCGCGCTCGAGAGTTTTGCAG
GTGGCCGCGGGCCCGGCGCCGGCGTCGCGCGCATCGCGCTCGCCCAGCTCAACAAGGGTCATTGA
 Primer design