SecReT4
Protein ID: 10956937
T4SS name [ID]Tra_F [526]
Gene symboltraU
Locus tagpNL1_p109
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]111947..112969 [-]
Productsex pilus assembly and synthesis protein
Component typeTraU_F
UniProt IDO85937
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 9.7e-84, Aligned region: 34..339
Protein Sequence: 340 a.a.     [Download]
>gi|10956937|ref|NP_049157.1| sex pilus assembly and synthesis protein [Novosphingobium aromaticivorans]
MTRLGRKFAALLAALALAFAVSAPARADTATCHGKFINPITDVCWSCLFPLSIGGLSIWKGSRPDPKNPS
FPLCACGSPIPRIGISVGFWEPVRLVDVTNKAWCFPNLGGIRLNPGFAIGNGHVQGRSQIGGKAQNSSQW
QSHYYVYPLLYWMEILTDFLCFEQTTFDVAYVTEIDPLWQDSALTSIINPEVALFSNPIATAACAADCVA
ATAKLPIDQMFWCAGCNGGMYPLNGHVAAHVTPIQASRLVAERMLYKMHREALAWGTMGSKALCHKYLMP
VMRKQQYRLQMTNPISTVKGRYACAPIGATTIIPQTGKGYPVKGEDFGYLVWRKRNCCML
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c112969-111947 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGACGCGGCTCGGCCGGAAATTCGCCGCCTTGCTCGCGGCGCTGGCGCTCGCCTTTGCGGTATCGGCGC
CCGCGCGCGCCGATACCGCCACCTGCCACGGCAAGTTCATCAACCCGATCACCGACGTGTGCTGGTCGTG
CCTGTTCCCACTGTCGATCGGCGGGCTCTCGATCTGGAAGGGCTCGCGCCCCGACCCCAAGAATCCCTCG
TTTCCCTTGTGCGCCTGCGGTTCGCCGATCCCGCGCATTGGTATCTCGGTGGGCTTTTGGGAGCCGGTGC
GGCTTGTCGACGTCACCAACAAGGCCTGGTGCTTTCCCAACCTTGGCGGAATCCGCCTCAACCCCGGCTT
CGCCATCGGCAATGGCCATGTCCAGGGCCGCAGCCAGATCGGCGGCAAGGCGCAGAACAGCTCGCAGTGG
CAGTCGCACTACTACGTCTACCCGCTGCTCTACTGGATGGAGATCCTGACCGACTTCCTTTGCTTCGAGC
AGACCACCTTCGATGTTGCCTATGTCACCGAGATTGACCCGCTCTGGCAGGATTCCGCGCTCACCTCGAT
CATCAATCCGGAAGTCGCGCTGTTCTCGAACCCGATCGCGACCGCGGCGTGTGCGGCCGACTGTGTCGCG
GCGACCGCCAAGCTGCCGATCGACCAGATGTTCTGGTGCGCGGGCTGCAACGGCGGGATGTACCCGCTGA
ACGGCCACGTCGCCGCGCATGTCACCCCGATCCAGGCCTCGCGGCTCGTCGCCGAACGCATGCTCTACAA
GATGCACCGCGAGGCGCTCGCCTGGGGGACGATGGGTTCGAAGGCGCTGTGCCACAAGTACCTGATGCCG
GTGATGAGGAAGCAGCAATACCGGCTGCAGATGACCAACCCGATCTCGACAGTGAAGGGCCGCTACGCCT
GCGCGCCGATCGGCGCGACCACCATCATTCCCCAGACCGGCAAGGGCTACCCCGTCAAGGGTGAGGACTT
TGGCTACCTCGTCTGGCGCAAGCGCAACTGCTGCATGCTGTGA
 Primer design