SecReT4
Protein ID: 10956939
T4SS name [ID]Tra_F [526]
Gene symboltraW
Locus tagpNL1_p111
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]113229..113924 [-]
Productsex pilus assembly and synthesis protein
Component typeTraW_F
UniProt IDO85939
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 231 a.a.     [Download]
>gi|10956939|ref|NP_049159.1| sex pilus assembly and synthesis protein [Novosphingobium aromaticivorans]
MRPFAALIAASGLALLVGWPGISGLRAADYGQMGQTFPIIETDLLTTIETRLRTLEANGGIERMQRQMQE
QAVASVRRPKPVDGMTPASVKREWLFDPSIVTEDDIVDAKGNLIAARGTRVNPLDMVQLSQALVFVDGDN
AAELAWAVKTWSDARAKIIFVSGSPFDAMKPWQRRFYFDQGGTLTAKFGIRHTPAVVSAAGANLKISEVP
LPPAAAAPARAPVLSGGGKVS
 
Nucleotide Sequence: 696 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c113924-113229 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
GTGAGGCCCTTCGCCGCCCTGATCGCCGCAAGCGGCCTTGCCCTGCTGGTCGGTTGGCCGGGCATCTCGG
GCCTGCGTGCTGCCGACTATGGGCAGATGGGTCAGACCTTTCCGATCATCGAGACCGATCTTCTCACCAC
GATCGAGACGCGGCTGAGGACGCTCGAGGCCAATGGCGGGATCGAGCGCATGCAGCGCCAGATGCAGGAA
CAAGCGGTCGCCAGCGTGCGCCGTCCCAAGCCGGTCGATGGCATGACCCCCGCAAGCGTCAAGCGCGAAT
GGCTGTTCGATCCCTCGATCGTCACGGAAGACGACATCGTCGATGCCAAGGGCAACCTGATCGCCGCGCG
CGGCACCCGGGTCAATCCGCTCGACATGGTGCAATTGAGCCAGGCGCTGGTCTTCGTCGATGGTGACAAT
GCGGCCGAGCTGGCCTGGGCGGTGAAAACCTGGAGCGATGCGCGGGCCAAGATCATCTTTGTCTCGGGCT
CGCCGTTCGATGCGATGAAGCCTTGGCAGCGGCGCTTCTACTTCGACCAGGGCGGCACGCTCACCGCCAA
GTTCGGCATCCGCCACACCCCCGCCGTGGTCTCGGCAGCGGGCGCCAATCTCAAGATCAGCGAAGTGCCG
CTACCGCCCGCGGCAGCCGCGCCCGCACGCGCACCCGTTCTCTCTGGCGGAGGCAAGGTGTCATGA
 Primer design