SecReT4
Protein ID: 10956942
T4SS name [ID]Tra_F [526]
Gene symboltraC
Locus tagpNL1_p114
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]115376..117946 [-]
Productsex pilus assembly and synthesis protein
Component typeTraC_F
UniProt IDO85942
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 6e-57, Aligned region: 18..265
AAA_10 [PF12846], Evalue: 1.7e-53, Aligned region: 464..755
TraG-D_C [PF12696], Evalue: 7.9e-05, Aligned region: 693..754
Protein Sequence: 856 a.a.     [Download]
>gi|10956942|ref|NP_049162.1| sex pilus assembly and synthesis protein [Novosphingobium aromaticivorans]
MLFGESAHPEAERPVLGAPMLSNWLPYRSYDKKHGLFINTDSLGFILELAPMMGADERSGELLTQFLSDA
VPSGCEIQLIHWQSPSVGERIADWVMPRVVAKGVYGRAAMHRARWLRRAAWMSISRDAPFYLRNTRVILS
VGARLSGPIGADTLASVRDSLHGTLQSLSIPARDMGPVELIAFLDDFLCPAVDNADKPEHYSELDPINVQ
CVRRDLETQVTPDRIVLQTERFRPTGERQDGAPVIGEVVPDKFDWRFFSVRNLPKQWAPWDVQKIIGDVI
NDKLRFGCNVMTVLGLVYQDEEAVASRAGLKVMRTTSLADSRSARFLPQLSEQRDEWQYVQAEIRQGRKL
AQVYYGVGALSPLGKGDINERMVKSVYKACGWDLIDERYLQVMGLLAAMPLSLPNGLSADLKRMKRFKTM
LTTTAASIAPLQGEHTGGHIPHVLLIGRRGQPFFWSPFQNAAGNHNVAVFGKSGSGKSVFLQDVCAAMSG
AGAKVIVIDDGRSFEHMVKAFGGAFVEFKLSSGFSLNPFDMIDGEALASDEDGEDYEVECLAMLKSIVGQ
MARQQDRLSDTERGLIDSAVSTVWREKQRHGTIDDVAAALRALPSPYAGDLADAMSPFLKGGTYGRFFEG
ACSIDLSAGLTVFELSDLSSKPELRSVALTALMFLTLRVMRDLDRSVPKLTMIDEAWQLLGGGQMGQAIE
TYARTCRKYGGSLITATQSLNDFYKSEGSLAALENSDWSIVLQQKEETINDLAKHQRFEMDHYTESLLRS
LKRNGTEYSDVLIKGPETLAVGRLVLDPYSATLYSSSPRVFSEIEDKVRGGLALPDAIERVAFPDFVPPE
PGAPDFAEGELAEAAE
 
Nucleotide Sequence: 2571 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c117946-115376 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGCTGTTCGGCGAAAGCGCGCATCCGGAGGCGGAGCGCCCGGTGCTCGGCGCGCCGATGCTGTCGAACT
GGCTGCCCTATCGAAGCTACGACAAGAAGCACGGCCTGTTCATCAACACGGACTCGCTCGGGTTCATTCT
CGAGCTGGCCCCGATGATGGGCGCAGACGAGCGCAGCGGCGAGCTGCTGACCCAGTTTCTGTCGGACGCC
GTGCCCTCGGGCTGCGAGATCCAGCTGATCCACTGGCAGAGTCCCTCGGTTGGCGAACGCATCGCTGATT
GGGTGATGCCGCGCGTGGTCGCCAAGGGGGTCTATGGCCGCGCGGCGATGCACCGGGCGCGCTGGCTGCG
CCGCGCCGCCTGGATGTCGATCTCGCGCGACGCACCGTTTTACCTGCGCAACACCCGGGTGATCCTCTCG
GTCGGTGCCCGGCTCAGTGGCCCGATCGGGGCCGACACGCTCGCCTCGGTGCGCGACAGTCTTCACGGGA
CGCTGCAGTCGCTCTCGATCCCGGCCCGCGACATGGGACCGGTCGAACTGATCGCCTTCCTCGACGATTT
TCTCTGCCCGGCGGTCGATAACGCCGACAAGCCCGAACACTATTCCGAGCTCGATCCGATCAACGTCCAG
TGCGTGCGGCGCGATCTCGAAACCCAGGTCACCCCTGACCGGATCGTGCTCCAGACCGAGCGCTTCCGCC
CCACTGGCGAGCGCCAGGACGGCGCGCCGGTGATCGGCGAGGTCGTGCCCGACAAGTTCGACTGGCGCTT
CTTCTCGGTGCGCAACCTCCCCAAACAATGGGCGCCGTGGGACGTCCAGAAAATCATCGGCGACGTCATC
AACGACAAGCTGCGCTTCGGCTGCAACGTCATGACCGTGCTCGGGCTCGTCTACCAGGACGAGGAAGCGG
TCGCCTCGCGCGCGGGCCTCAAGGTCATGCGCACCACCAGCCTTGCCGACAGCCGCTCGGCGCGCTTCCT
GCCCCAGCTCTCCGAGCAGCGCGACGAATGGCAATACGTTCAGGCCGAGATCCGCCAGGGCCGCAAGCTC
GCGCAGGTCTACTACGGCGTCGGCGCGCTCTCGCCCTTGGGCAAGGGCGACATCAACGAGCGCATGGTGA
AGTCGGTCTACAAGGCCTGCGGGTGGGACCTCATCGACGAGCGCTACCTCCAGGTGATGGGGCTGCTCGC
AGCGATGCCGCTGTCGCTCCCCAATGGGCTCTCGGCTGACCTGAAGCGCATGAAGCGCTTCAAGACCATG
CTCACCACCACCGCGGCCTCGATCGCGCCGCTCCAGGGCGAGCACACCGGCGGGCACATCCCGCACGTTC
TGCTCATCGGCCGGCGCGGGCAGCCGTTCTTCTGGTCGCCGTTCCAGAACGCGGCGGGCAATCACAACGT
CGCCGTTTTCGGCAAGTCGGGCTCGGGCAAGTCGGTATTCCTGCAGGACGTCTGTGCCGCGATGTCCGGC
GCGGGGGCCAAGGTCATCGTGATCGATGACGGCCGCTCGTTCGAGCACATGGTCAAAGCCTTCGGCGGCG
CTTTCGTCGAGTTCAAGCTATCCTCTGGCTTCTCGCTCAATCCCTTCGACATGATCGACGGCGAGGCGCT
AGCGAGCGACGAGGACGGCGAGGACTATGAGGTCGAATGCCTCGCGATGCTCAAATCGATCGTCGGCCAG
ATGGCGCGCCAGCAGGACCGCTTGTCCGACACCGAGCGCGGGCTGATCGATTCCGCGGTGAGCACGGTCT
GGCGCGAGAAACAGCGCCATGGGACGATTGACGATGTTGCCGCGGCGCTGCGCGCGCTGCCTTCGCCCTA
TGCCGGCGATCTTGCCGATGCGATGTCGCCGTTCCTAAAAGGCGGCACCTATGGCCGCTTTTTCGAAGGC
GCCTGCTCGATCGACCTCTCGGCCGGGCTCACCGTGTTCGAGCTCTCCGACCTCTCCTCGAAGCCCGAAC
TGCGCTCGGTCGCGCTGACCGCGCTCATGTTCCTGACACTTCGGGTGATGCGCGATCTCGACCGCTCGGT
GCCCAAGCTGACGATGATCGACGAAGCCTGGCAACTCCTTGGCGGCGGGCAGATGGGCCAGGCGATCGAG
ACCTATGCCCGCACCTGCCGCAAATATGGCGGCTCGCTGATCACAGCGACCCAGTCGCTCAACGACTTCT
ACAAGTCGGAAGGTTCGCTCGCCGCACTCGAAAACTCGGACTGGTCGATCGTCCTCCAGCAGAAGGAAGA
GACGATCAACGATCTCGCCAAGCACCAGCGCTTCGAGATGGACCATTACACGGAAAGCCTGCTCCGCTCG
CTGAAGCGCAACGGGACCGAGTATTCCGACGTCCTGATCAAAGGCCCCGAGACGCTTGCTGTAGGGCGCC
TTGTGCTCGATCCCTATTCGGCGACGCTCTATTCCTCGAGCCCCCGGGTCTTTTCCGAGATCGAGGACAA
GGTGCGCGGCGGCCTGGCGCTCCCCGATGCGATCGAGCGGGTGGCCTTCCCCGATTTCGTGCCGCCCGAG
CCCGGCGCGCCCGACTTTGCCGAGGGCGAGCTTGCGGAGGCGGCCGAATGA
 Primer design