SecReT4
Protein ID: 10956943
T4SS name [ID]Tra_F [526]
Gene symbolorf876
Locus tagpNL1_p115
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]118097..119140 [-]
Producthypothetical protein
Component typeTraV_F
UniProt IDO85943
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 2.3e-12, Aligned region: 138..241
Protein Sequence: 347 a.a.     [Download]
>gi|10956943|ref|NP_049163.1| unknown [Novosphingobium aromaticivorans]
MTALSSKHLASLTRAVARRSCGRVSLPRVELSRAEAIQLWQDLVLATAVPRGVLLTPREQALLGKRAWAR
SAGHVALGEAPLSRQSGLAIWRLAIRLGDLAARRSPNPVTRAASIAAIGLAATQLAACTSLFGGNIKGSF
ACSAPGGTCAPSTVIDDQALSVIQNARPMTPAGPYIRQPAAAKPVTASYTPSGSGRITSAGGGMVHRERR
VLKVVFPSFVDGGGNLHEPRIIHAVVDNGAWMELSSGEPNIGEQVEGRAVSLASAAFVPAPVPVAPIAQD
AGSPTPKAIDAAPSGPPRPEAVAAARAKGAALQSGNAIEAIQAQVQARLAPTAKAHVPGSSGTCGAQ
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c119140-118097 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
GTGACCGCGCTCAGCTCCAAGCATCTTGCGAGCCTCACGCGCGCAGTCGCGCGGCGCTCTTGTGGGCGAG
TCTCGCTGCCGCGGGTGGAGCTCAGCCGCGCCGAAGCAATCCAGCTGTGGCAGGATCTCGTCCTTGCCAC
TGCGGTTCCGCGAGGCGTGCTGCTCACGCCTCGCGAACAGGCATTGCTGGGCAAGCGCGCGTGGGCGCGC
TCGGCGGGCCATGTCGCGCTTGGTGAGGCTCCGCTGTCGCGCCAATCGGGCCTCGCCATCTGGCGGCTCG
CGATCCGGCTTGGGGATCTTGCGGCGCGGCGATCGCCAAACCCCGTCACCCGGGCTGCAAGCATCGCGGC
CATCGGACTCGCGGCTACCCAGCTCGCCGCCTGCACCTCGCTGTTCGGCGGCAACATCAAGGGCAGCTTT
GCCTGCAGCGCACCAGGCGGGACCTGCGCGCCTTCGACGGTGATCGACGACCAGGCGCTGTCGGTGATCC
AGAATGCCCGGCCGATGACCCCGGCAGGGCCGTACATCCGCCAGCCCGCCGCCGCCAAGCCGGTTACTGC
GTCGTACACGCCGTCGGGTTCGGGCCGCATCACCTCGGCCGGCGGCGGCATGGTCCACCGCGAGCGCCGC
GTGCTCAAGGTGGTGTTCCCCTCTTTCGTCGATGGTGGTGGCAATCTCCACGAACCGCGGATCATCCACG
CAGTGGTCGACAACGGCGCCTGGATGGAGCTGTCCTCGGGCGAGCCCAATATCGGCGAGCAGGTCGAGGG
CAGGGCAGTTAGCCTCGCGAGCGCGGCATTCGTGCCGGCACCGGTACCCGTCGCCCCGATCGCCCAGGAC
GCTGGGTCACCCACTCCCAAAGCAATAGATGCCGCGCCTTCCGGGCCGCCGCGCCCCGAGGCCGTTGCGG
CGGCGCGCGCCAAGGGTGCCGCGCTCCAGTCGGGCAATGCGATCGAGGCGATTCAGGCTCAGGTGCAGGC
GCGTCTCGCGCCCACTGCGAAAGCGCACGTCCCTGGCAGCAGCGGTACGTGCGGCGCCCAGTAG
 Primer design