SecReT4
Protein ID: 10956945
T4SS name [ID]Tra_F [526]
Gene symboltraB
Locus tagpNL1_p117
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]120044..121420 [-]
Productsex pilus assembly and synthesis protein
Component typeTraB_F
UniProt IDO85945
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 9.5e-35, Aligned region: 248..454
Protein Sequence: 458 a.a.     [Download]
>gi|10956945|ref|NP_049165.1| sex pilus assembly and synthesis protein [Novosphingobium aromaticivorans]
MDWKNPFRKGPKALDGPATHPGSGDASPLGDAIVANEAVRKKQMLLLGAGGLAALVIGSSWIFAGDHKSS
DASVKRQVADVSVDEMVNKNMAEKEWRAQSEAQMMSMDTNMRALAARAQRADQLEAQLAQGQAAQSTSGG
GISPDTERVLSAYQNENEQLKAALAAARQSPVMGAGATPVGPNALYGRTSPPSYQTAPSTPAGQAAMAAA
GLPAGRGSEVSLVSFNEGASGTGSPVPKGNTVFTDSANYLPPNSIAVAKVIVGVDAAAGVQSQTDPLPVV
LRITGPARSVYDNGRLLTTNIAGCLVNGAARGDLSSEKVYVKLQRMTCPQPNGRYAVSDVKGFIAFGGKT
GVRGRVVSREGSLIGQAFLAGLAGGFGRGFAANTNSTLTGTNVNVNGQRQKLGTGDILEGGLGEGIATSG
DMVSKYLIERAEQYQPVIEMPTGIDVEIVFLEGVFING
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c121420-120044 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGGACTGGAAGAACCCGTTCCGCAAAGGCCCCAAGGCGCTCGACGGTCCCGCAACCCACCCTGGAAGTG
GTGACGCCTCGCCGCTCGGCGATGCAATCGTGGCCAATGAGGCGGTCAGGAAGAAGCAGATGCTGCTGCT
CGGCGCTGGCGGTCTTGCCGCGCTTGTCATCGGCTCCTCGTGGATCTTCGCCGGCGATCACAAGAGCAGC
GACGCCAGCGTCAAGCGGCAGGTCGCCGACGTCTCGGTCGACGAGATGGTCAACAAGAACATGGCCGAGA
AGGAGTGGCGTGCCCAGTCCGAGGCGCAGATGATGTCGATGGACACCAACATGCGCGCGCTCGCTGCCCG
TGCGCAGCGGGCCGACCAGTTGGAAGCGCAGCTGGCCCAGGGTCAGGCAGCGCAGAGCACGTCAGGCGGC
GGGATATCTCCCGACACCGAGCGGGTGCTTTCCGCCTACCAGAACGAGAATGAGCAGTTGAAGGCAGCGC
TCGCAGCCGCGCGCCAGTCGCCGGTCATGGGTGCCGGCGCGACACCGGTCGGACCCAACGCGCTTTACGG
GCGGACCAGCCCACCGAGCTACCAGACCGCGCCCAGCACGCCTGCCGGGCAAGCCGCAATGGCCGCGGCG
GGACTCCCGGCAGGGCGCGGGAGCGAGGTCAGCCTGGTCTCGTTCAACGAGGGCGCAAGCGGAACCGGAA
GCCCGGTCCCCAAGGGCAACACTGTCTTCACCGACAGCGCCAATTACCTGCCGCCGAACTCGATCGCGGT
CGCCAAGGTCATAGTCGGGGTCGATGCGGCCGCCGGCGTCCAGAGTCAGACCGATCCCCTGCCGGTCGTG
CTGCGCATCACCGGCCCTGCGCGCTCGGTCTACGACAACGGGCGGCTGCTCACGACCAATATCGCCGGAT
GCCTGGTCAACGGCGCGGCGCGCGGCGACCTCTCGAGCGAGAAGGTCTACGTCAAGCTGCAGCGCATGAC
CTGCCCGCAGCCCAATGGCCGTTACGCGGTCTCGGACGTCAAGGGCTTCATCGCCTTCGGCGGCAAGACC
GGGGTCAGGGGGAGGGTGGTCAGCCGGGAAGGTTCGCTGATCGGCCAGGCCTTCCTTGCCGGTCTCGCCG
GCGGCTTTGGCCGCGGCTTTGCCGCCAACACCAATTCGACGCTCACCGGAACAAACGTCAACGTCAATGG
GCAGCGCCAGAAGCTCGGCACCGGCGACATCCTCGAGGGCGGGCTCGGCGAAGGCATCGCCACCTCGGGC
GACATGGTCAGCAAGTACCTGATCGAGCGGGCCGAACAGTACCAGCCCGTGATCGAGATGCCGACCGGGA
TCGATGTCGAAATCGTGTTTCTCGAAGGCGTGTTCATCAACGGGTGA
 Primer design