SecReT4
Protein ID: 10956946
T4SS name [ID]Tra_F [526]
Gene symboltraK
Locus tagpNL1_p118
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]121420..122214 [-]
Productsex pilus assembly and synthesis protein
Component typeTraK_F
UniProt IDO85946
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 9.4e-43, Aligned region: 34..256
Protein Sequence: 264 a.a.     [Download]
>gi|10956946|ref|NP_049166.1| sex pilus assembly and synthesis protein [Novosphingobium aromaticivorans]
MAELGWGAIGVGSVLAGRPYAINGRPVGAALICFGALCLAAPAMADQSIPAADNGTVACVASAKDLTRIS
LAGDQFASVSKISTGNPAEDFKIVNEPVRGDIYISVPDGFTKPNLSFFGTTRKGYVYKFLCQVRGNDAEQ
VFVTNTAIKTEAARDWEVRSSPEDAAVRLAQAMYRSETIEGFEIRQSVLEPVAVGKLEVQQVGEYRGADL
KGLILKVRNTGAKPLTLDENLLAARGSVAFMTPVSELAPGQAAAVYLIQSNGGQ
 
Nucleotide Sequence: 795 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c122214-121420 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGGCCGAACTGGGTTGGGGCGCGATCGGGGTGGGCAGCGTGCTCGCCGGACGGCCCTATGCAATCAATG
GCCGCCCGGTTGGCGCCGCGCTCATCTGCTTCGGTGCGCTGTGCCTTGCCGCACCCGCCATGGCCGACCA
GAGCATTCCCGCTGCTGACAATGGTACGGTCGCCTGTGTCGCCTCGGCGAAGGACCTCACCCGGATCAGC
CTTGCGGGAGACCAGTTCGCCTCGGTCTCGAAGATCAGCACCGGCAACCCGGCCGAGGACTTCAAGATCG
TCAACGAGCCCGTGCGCGGGGACATCTACATTTCGGTGCCCGATGGCTTCACCAAGCCCAACCTCTCGTT
CTTCGGCACGACCCGAAAGGGCTACGTCTACAAGTTCCTCTGCCAGGTCCGCGGCAACGACGCCGAGCAG
GTCTTCGTCACCAACACGGCGATCAAGACCGAGGCCGCGCGCGATTGGGAAGTGCGCTCTTCGCCCGAGG
ATGCCGCCGTGCGCCTCGCGCAAGCCATGTATCGCAGCGAGACCATCGAAGGCTTCGAGATCAGGCAAAG
CGTGCTCGAGCCGGTCGCGGTCGGCAAGCTCGAGGTCCAGCAGGTCGGCGAATACCGCGGCGCTGACCTC
AAGGGACTGATCCTCAAGGTCCGCAACACCGGCGCAAAGCCGCTCACTCTCGATGAGAACCTGCTCGCCG
CGCGCGGCAGCGTCGCCTTCATGACCCCGGTGAGCGAGCTCGCGCCCGGCCAGGCGGCCGCTGTCTACCT
CATCCAATCGAATGGAGGCCAGTGA
 Primer design