SecReT4
Protein ID: 10956947
T4SS name [ID]Tra_F [526]
Gene symboltraE
Locus tagpNL1_p119
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]122214..122837 [-]
Productsex pilus assembly and synthesis protein
Component typeTraE_F
UniProt IDO85947
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.1e-69, Aligned region: 1..183
Protein Sequence: 207 a.a.     [Download]
>gi|10956947|ref|NP_049167.1| sex pilus assembly and synthesis protein [Novosphingobium aromaticivorans]
MDLSISHGQAQRLLKQRNLLAITATGLFALSVVLTFTAAHRDREVVLQPVLAKPLTLSSSHIDKDYLELV
TRDAALLTLNRSPSNLQYWMDSILAITDPRTHGRMKAELMKIFNEQNGSNVSQFFTIENLSVDPEALTSE
VNGVLHTVVGSKEVTSEARTFRYVWSYSGVSLKLAGFGRVTKDPSGKVIDAKGAGSAQSDNSDGGEA
 
Nucleotide Sequence: 624 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c122837-122214 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGGACCTCTCGATTTCTCACGGCCAGGCGCAGCGGCTCTTAAAGCAGCGCAACCTCCTCGCGATCACCG
CGACCGGGCTGTTTGCCCTGAGCGTGGTGTTGACGTTCACCGCCGCGCACCGCGACCGCGAAGTGGTGCT
GCAGCCGGTGCTGGCGAAGCCGCTGACGCTGTCCTCGAGCCACATCGACAAGGATTACCTTGAGCTCGTC
ACGCGCGATGCCGCGCTGCTGACACTCAACCGCTCGCCGTCCAACCTGCAGTACTGGATGGATTCGATCC
TGGCGATCACCGATCCCAGAACCCACGGCCGGATGAAGGCCGAACTGATGAAGATCTTCAACGAGCAGAA
CGGCTCGAATGTCTCGCAGTTCTTCACGATCGAGAACCTCTCTGTCGATCCCGAGGCACTGACCAGCGAG
GTCAACGGCGTGCTGCACACGGTGGTCGGCTCCAAGGAGGTGACCTCCGAAGCCCGGACCTTCCGCTACG
TGTGGAGCTACTCGGGCGTCAGCCTCAAGCTCGCCGGGTTCGGGCGCGTGACCAAGGATCCGTCGGGCAA
GGTCATCGACGCCAAGGGCGCGGGCAGCGCGCAATCAGACAATAGCGACGGGGGAGAGGCGTGA
 Primer design