SecReT4
Protein ID: 10956948
T4SS name [ID]Tra_F [526]
Gene symboltraL
Locus tagpNL1_p120
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]122851..123135 [-]
Productsex pilus assembly and synthesis protein
Component typeTraL_F
UniProt IDO85948
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.3e-37, Aligned region: 3..93
Protein Sequence: 94 a.a.     [Download]
>gi|10956948|ref|NP_049168.1| sex pilus assembly and synthesis protein [Novosphingobium aromaticivorans]
MNRYTVPAHLDDPELIGFWTLDEFLAMIVPFAWGILSQHIFIGLCSSVLAWWGLRKLKAGRAVSWIIHSA
YWYLPGAFMGLRATPPSHLRLMAG
 
Nucleotide Sequence: 285 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c123135-122851 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
ATGAATCGCTACACGGTTCCCGCGCATCTCGATGATCCGGAGCTGATCGGGTTTTGGACACTCGATGAGT
TTCTCGCGATGATCGTTCCCTTCGCCTGGGGCATCCTGTCTCAACATATTTTCATCGGTCTATGTTCAAG
CGTGCTGGCCTGGTGGGGATTGCGCAAGTTGAAGGCGGGACGAGCCGTCTCGTGGATCATTCATTCGGCC
TACTGGTACCTGCCGGGTGCCTTTATGGGGCTGAGAGCGACGCCGCCCTCCCATCTTCGCCTGATGGCGG
GCTGA
 Primer design