SecReT4
Protein ID: 10956953
T4SS name [ID]Tra_F [526]
Gene symbolorf925
Locus tagpNL1_p125
StrainNovosphingobium aromaticivorans plasmid pNL1 (NC_002033)
Repliconplasmid pNL1 [GenBank: NC_002033] [Browse all T4SS(s) in this replicon]
Location [Strand]125077..125874 [-]
Producttransglycosylase
Component typeOrf169_F
UniProt IDO85953
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 265 a.a.     [Download]
>gi|10956953|ref|NP_049173.1| transglycosylase [Novosphingobium aromaticivorans]
MILTYAKIVAVAAMVFVAPAKAREVDLSRFAPSAIAASGGDGPVEVALRAHLQGISQPVYIIDKIGKGAS
ASQNPLSCPGNGYLQTWWLPAEVEKRRATYFEAMSQIACENGLPASLLDAVVAQESGYKAWAISRAGAMG
MMQVMPGTARHLELWNPWDALANMRAGARYLRQQLDRFERVDLALAAYNAGPERRSLTLGYIPAIPETRN
YVRTITTNWLRLTQLNRPDSSSLARATAASTAVWASGYREVSLVTYDGTNSANPI
 
Nucleotide Sequence: 798 bp     [Download]
>gi|10956828|ref|NC_002033.1|:c125874-125077 Novosphingobium aromaticivorans plasmid pNL1, complete sequence
GTGATTTTGACTTACGCAAAAATAGTCGCAGTCGCTGCGATGGTCTTCGTTGCCCCTGCGAAGGCAAGGG
AAGTGGATTTGTCTCGCTTCGCTCCTTCTGCCATTGCGGCCAGTGGCGGAGATGGTCCTGTCGAGGTTGC
GCTACGCGCTCATTTGCAAGGTATCAGCCAACCTGTCTATATAATTGATAAAATTGGCAAAGGAGCCAGC
GCAAGCCAGAACCCGCTGTCTTGTCCTGGGAATGGTTACCTCCAGACATGGTGGTTGCCGGCCGAGGTGG
AGAAACGCCGAGCAACGTACTTTGAAGCGATGTCGCAAATCGCCTGCGAGAATGGCCTGCCCGCCAGCTT
GCTGGATGCAGTTGTTGCCCAAGAGTCAGGATACAAGGCTTGGGCAATCAGCAGGGCCGGCGCAATGGGA
ATGATGCAGGTTATGCCCGGAACCGCCAGGCATCTGGAGCTATGGAACCCTTGGGACGCCTTGGCGAACA
TGCGCGCGGGCGCGCGATATCTTCGCCAGCAACTTGATCGTTTTGAACGCGTCGATCTCGCCCTGGCCGC
CTACAATGCCGGACCAGAGCGCCGCTCCCTCACGCTGGGCTATATCCCAGCGATCCCCGAAACCCGCAAT
TACGTGCGAACCATCACAACCAACTGGCTCCGCCTTACCCAGCTCAATCGTCCAGATTCCAGCTCTCTTG
CGCGAGCGACAGCAGCCAGCACAGCCGTCTGGGCATCAGGCTACCGCGAGGTTTCATTGGTCACCTACGA
CGGGACGAATTCCGCAAACCCGATATAG
 Primer design