SecReT4
Protein ID: 10957222
T4SS name [ID]Tra_F [569]
Gene symboltrhL
Locus tagR27_p033
StrainSalmonella enterica subsp. enterica serovar Typhi plasmid R27 (NC_002305)
Repliconplasmid R27 [GenBank: NC_002305] [Browse all T4SS(s) in this replicon]
Location [Strand]37316..37633 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDQ9L5U4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.9e-08, Aligned region: 11..82
Protein Sequence: 105 a.a.     [Download]
>gi|10957222|ref|NP_058246.1| hypothetical protein R27_p033 [Salmonella enterica subsp. enterica serovar Typhi]
MTSQYEIPPHTYRFPYRINMPLLILFWDAKQLGITFVTIASGNIFDFFITSVVVAVVFWFAYKKAAEEGI
RGKLKHKLWWYGFFPGKSVFSSRYFTDPFIRNLYS
 
Nucleotide Sequence: 318 bp     [Download]
>gi|10957190|ref|NC_002305.1|:c37633-37316 Salmonella typhi plasmid R27, complete sequence
ATGACAAGCCAGTACGAGATACCGCCACATACATATCGCTTTCCATACAGAATAAATATGCCGTTACTAA
TTCTATTCTGGGATGCAAAGCAATTGGGTATAACATTCGTGACTATCGCGAGCGGTAATATTTTTGATTT
CTTTATAACTTCGGTAGTTGTGGCGGTGGTGTTCTGGTTTGCATATAAGAAAGCAGCAGAGGAAGGGATT
AGAGGAAAACTAAAACACAAACTGTGGTGGTACGGCTTTTTTCCTGGAAAATCGGTGTTTAGTAGTCGTT
ACTTTACCGATCCATTTATCAGAAACCTCTATTCTTGA
 Primer design